[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35861.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  79/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:247 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  54->79 2fiwA1  d.108.1.1 * 6e-04 34.6 %
:RPS:PFM   98->233 PF01927 * DUF82 4e-35 50.7 %
:HMM:PFM   97->239 PF01927 * DUF82 8.6e-48 48.3 143/147  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35861.1 GT:GENE AAD35861.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(805341..806084) GB:FROM 805341 GB:TO 806084 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GP:2909638 percent identity: 60.85; identified by sequence similarity; putative GB:PROTEIN_ID AAD35861.1 GB:DB_XREF GI:4981308 LENGTH 247 SQ:AASEQ MKYEKIAFFRFFGRLNDFFRNSERIKTHRFTGFQTVKDRIEALGVPHVEVSLITLNGKPVGFDHMVEDGELFFVYPEFQNIEIPEDWLVTPRYIGEPRFVLDIHLGKLARLLRMLGFEAVFGEESDEKLCWMAVKKKAILLSRDTGLLKRKELVFGYYVRNTDPKEQLVEVVERYDLKKWMKPFTRCIECGVELEEVPKEAVKNRVPPKVYGFFNEFARCPVCGRIYWKGSHYDHMVEFIKSNINKG GT:EXON 1|1-247:0| SEG 8->20|ffrffgrlndffr| RP:PFM:NREP 1 RP:PFM:REP 98->233|PF01927|4e-35|50.7|136/145|DUF82| HM:PFM:NREP 1 HM:PFM:REP 97->239|PF01927|8.6e-48|48.3|143/147|DUF82| RP:SCP:NREP 1 RP:SCP:REP 54->79|2fiwA1|6e-04|34.6|26/156|d.108.1.1| OP:NHOMO 115 OP:NHOMOORG 105 OP:PATTERN 111-1-1--------11------------1-1----------------------11111111-1---- --1------------1111-1---1-11111-----1-11--------------------------11111-----------11-------------------------------------------------------1111--1-1--11-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1----------------------------------------------------------------------------------------------------------------------------------1111-1-----11111111111-11111--111-------1-----11--------------11---1---1------------------1--111-1-----------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------11---212221-- ------1------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1---7-----11-1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccEEEEEEEccHHccccccccccccccccccccHHHHHHHcccccccEEEEEEccEEcccccccccccEEEEEcEEEccccccccccccccccccEEEEHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHccccEEEEccHHHHHHHHccccEEEEcccHHHHHHHHHHHccccccccHHHHHHHcccEEEEccHHHHHHHccHHHHccccEEEEEccccEEEccccHHHHHHHHHHHHHHcc //