[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35882.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  495/915 : Eukaryota  97/199 : Viruses  0/175   --->[See Alignment]
c.1.4c.1.5
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->313 3bo9A PDBj e-139 95.3 %
:RPS:PDB   2->313 3bo9A PDBj 1e-59 89.4 %
:RPS:SCOP  31->245 1bwkA  c.1.4.1 * 1e-15 15.2 %
:HMM:SCOP  3->312 1pvnA1 c.1.5.1 * 4.7e-67 32.8 %
:RPS:PFM   9->300 PF03060 * NPD 1e-54 51.2 %
:HMM:PFM   4->300 PF03060 * NPD 7.9e-113 50.5 297/323  
:BLT:SWISS 1->307 2NPD_STAS1 2e-44 39.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35882.1 GT:GENE AAD35882.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(821189..822133) GB:FROM 821189 GB:TO 822133 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000782 percent identity: 62.64; identified by sequence similarity; putative GB:PROTEIN_ID AAD35882.1 GB:DB_XREF GI:4981329 LENGTH 314 SQ:AASEQ MTVRTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSVNIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFARKIQEMEFENPMQAEEMLVGSLRRAVVEGDLERGSFMVGQSAGLIDEIKPVKQIIEDILKEFKETVEKLRGYIEE GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 1->307|2NPD_STAS1|2e-44|39.9|306/355| SEG 180->189|aaafalgaea| BL:PDB:NREP 1 BL:PDB:REP 2->313|3bo9A|e-139|95.3|301/302| RP:PDB:NREP 1 RP:PDB:REP 2->313|3bo9A|1e-59|89.4|301/302| RP:PFM:NREP 1 RP:PFM:REP 9->300|PF03060|1e-54|51.2|291/312|NPD| HM:PFM:NREP 1 HM:PFM:REP 4->300|PF03060|7.9e-113|50.5|297/323|NPD| GO:PFM:NREP 2 GO:PFM GO:0018580|"GO:2-nitropropane dioxygenase activity"|PF03060|IPR004136| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03060|IPR004136| RP:SCP:NREP 1 RP:SCP:REP 31->245|1bwkA|1e-15|15.2|210/399|c.1.4.1| HM:SCP:REP 3->312|1pvnA1|4.7e-67|32.8|290/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 1123 OP:NHOMOORG 594 OP:PATTERN -----------------------11------------------------------------------- 111-31-1---1-143344-45--35434442655536B9-1-----------111-1--225-1213131--------114--111111211211---112112511-1------------------------------------1--1--------------1--1------------------1111--11111111111111111-31111111133221-22222221-111111111111111--211---11-1---11--11-1-11111-11121111211111111111111111111211111111111111-22222222222222-222111112---222322222121211111-221---5445-----1-62221-31421-------------11--3-11-7-1---21--111-2215--211-11-1222222222111112211111111111---------------1111-33572111182114434111122642111216344685--222--13321113121-1---2------------1229231111111111111111111-111111--1111111111111111111111111--11--3---3111--1---1111-111------------------------------------------------------122----------1--11-------------------------------------1111-1-111112-------1---112-1-211-1133332-1-12121-222--------------------1-------------1111--2-111111----------1-------------------------1222211111-1- ----1-1-31--22356647353746644343434333232334335434444333333333-11-11----1-1-----1---1----5B363334221113232--2-------------------------------------------------1-------------------17111-1113132121--1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 99.7 SQ:SECSTR cccccHHHHHHTccccEEcccTTTTccHHHHHHHHHTTccEEEEccTTcHHHHHHHHHHHHTTccccEEEEEETTcTTHHHHHHHHHHTTccEEEEEccccHHHHHHHHHTTcEEEEEEccHHHHHHHHHTTcccEEEEcTTccEEcccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHTccEEEcHHHHTcccccccHHHHHHHHHccTTcEEEEcTTTTccEEEEccHHHHHHHHHHcccHcHHHHHHTTHHHHHHTTccTTTccccccGGGGGccccccHHHHHHHHHHHHHHHHHHHHHHTc# DISOP:02AL 1-3, 313-314| PSIPRED cccccccHHHccccccEEEccccccccHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEHHHHHHHccccccccHHHHHHHHccccccEEEEEEccccEEEHccHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc //