[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35889.1
DDBJ      :             alkyl hydroperoxide reductase, putative
Swiss-Prot:TDXH_THEMA   RecName: Full=Probable peroxiredoxin;         EC=1.11.1.15;

Homologs  Archaea  57/68 : Bacteria  749/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->212 2e2gB PDBj 4e-75 61.0 %
:RPS:PDB   3->214 2cv4A PDBj 6e-43 55.3 %
:RPS:SCOP  7->214 1prxA  c.47.1.10 * 7e-39 39.9 %
:HMM:SCOP  2->215 1x0rA1 c.47.1.10 * 5.3e-79 45.8 %
:RPS:PFM   8->136 PF00578 * AhpC-TSA 7e-22 43.8 %
:HMM:PFM   8->137 PF00578 * AhpC-TSA 2.9e-38 42.3 123/124  
:HMM:PFM   158->200 PF10417 * 1-cysPrx_C 1.9e-16 60.5 38/40  
:BLT:SWISS 1->215 TDXH_THEMA e-127 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35889.1 GT:GENE AAD35889.1 GT:PRODUCT alkyl hydroperoxide reductase, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 830496..831143 GB:FROM 830496 GB:TO 831143 GB:DIRECTION + GB:PRODUCT alkyl hydroperoxide reductase, putative GB:NOTE similar to GB:L77117 PID:1591451 percent identity: 87.96; identified by sequence similarity; putative GB:PROTEIN_ID AAD35889.1 GB:DB_XREF GI:4981337 LENGTH 215 SQ:AASEQ MEGRIPLIGEEFPRVEVKTTHGKKVLPDDFRGKWFVLFSHPADFTPVCTTEFVAFQKRYDEFRKLNTELIGLSIDQVFSHIKWIEWIKEKLGVEIEFPVIADDLGEVSRRLGLIHPNKGTNTVRAVFIVDPNGIIRAIVYYPQEVGRNIDEILRAVKALQTSDEKGVAIPANWPSNELINDSVIVPPASSVEEARKRLESKDFECYDWWFCYKKV GT:EXON 1|1-215:0| SW:ID TDXH_THEMA SW:DE RecName: Full=Probable peroxiredoxin; EC=1.11.1.15; SW:GN OrderedLocusNames=TM_0807; SW:KW Antioxidant; Complete proteome; Oxidoreductase; Redox-active center. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->215|TDXH_THEMA|e-127|100.0|215/215| GO:SWS:NREP 3 GO:SWS GO:0016209|"GO:antioxidant activity"|Antioxidant| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 5->212|2e2gB|4e-75|61.0|205/239| RP:PDB:NREP 1 RP:PDB:REP 3->214|2cv4A|6e-43|55.3|208/236| RP:PFM:NREP 1 RP:PFM:REP 8->136|PF00578|7e-22|43.8|121/122|AhpC-TSA| HM:PFM:NREP 2 HM:PFM:REP 8->137|PF00578|2.9e-38|42.3|123/124|AhpC-TSA| HM:PFM:REP 158->200|PF10417|1.9e-16|60.5|38/40|1-cysPrx_C| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 7->214|1prxA|7e-39|39.9|203/220|c.47.1.10| HM:SCP:REP 2->215|1x0rA1|5.3e-79|45.8|214/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 2348 OP:NHOMOORG 1003 OP:PATTERN 331111533333333412111221---1-1----111111211-2-1212123-13123445441111 3233111----11111111-1-11211111121---1121-3-4---1----1-1-------11-1-2221-11111111111321123322-2222--213331542-311111111111111233333222333-11111114-63665546633333233445555653323433234332211132-322222222222222222223323222223211111111143122222222211222222121-1-11-1-----1111---11-1111111111-11-----------1111111111111---------114112-------1-1-211-11-2111111-1-112---11--223-3113123222-----322222211212211111111111-111212--221-311-1131111132113121----222333333331442322322222222112522221222212212121-315112333344444434444445544443454643442144423222224233332263611-------114123213--232143221-3242222-12223251-3222222222211111111123233222223522322-22222232222221222221-232-111111121221211111111111-11211111111111111112222211222222222222222221111111111111111111111111433333333323223---1-1-1--1-111222221522233555534433333322222-1111-1-311121111122222111111111111111111443333--------11--------------------------2233321222--1 3311745-A8333333244233222221111111111111111111221123231111111133333323333332322334232211-34122322222211545132197C66684344454C8372IV9176D4434946755554463254555655434444A5573444133183213674864473295B63 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 100.0 SQ:SECSTR cccccccTTcccccEEEETTEEEEEHHHHTTTcEEEEEEccccccHHHHHHHHHHHHTHHHHHHTTEEEEEEEcccHHHHHHHHHHHHHHTcccccccEEEcTTcHHHHHTTcccTTccccccEEEEEEcTTccEEEEEEEEcTccccHHHHHHHHHHHHHHHHTTccccTTTTccTTTcTcEEccccccHHHHHHcccccccEEEETTEEEEcc DISOP:02AL 1-2| PSIPRED ccccccccccccccEEEEcccccEEEHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHccccccccccccccEEEEEEcccEEEEEEEccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccEEEcccccHHHHHHHHcccccEEEccEEEEEcc //