[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35916.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 76->175 RFCL_PYRKO 1e-04 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35916.1 GT:GENE AAD35916.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 859573..860127 GB:FROM 859573 GB:TO 860127 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35916.1 GB:DB_XREF GI:4981366 LENGTH 184 SQ:AASEQ MRSLRVLLITMIVLYILFFVNSFFQSRREHVRVPEKVYSYLIENFNISPKSIIIDSKKAIGIVFYEGNYYLCAEDGSLVASLSKKDLFKFYPVFLEVNLEGLRLSKSDREILEMLIPILKSSVVSAVFFESKEVVLLKGSRIMFEEWKDLVENFQVIMEQSEKMKAKERYFLTDDGRLMWIRGD GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 76->175|RFCL_PYRKO|1e-04|33.3|90/499| TM:NTM 4 TM:REGION 3->25| TM:REGION 51->72| TM:REGION 75->97| TM:REGION 109->130| SEG 47->62|ispksiiidskkaigi| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccEEEEEcccEEEEEEEEccEEEEEccccEEEcccHHHHHHHEEEEEEEEcccEEEcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccEEEEEEcc //