[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35920.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:401 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   145->162 PF07495 * Y_Y_Y 0.00046 50.0 18/66  
:HMM:PFM   5->31 PF07544 * Med9 0.00032 33.3 27/67  
:TM
:REPEAT 3|66->159|177->268|293->385
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35920.1 GT:GENE AAD35920.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 864148..865353 GB:FROM 864148 GB:TO 865353 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35920.1 GB:DB_XREF GI:4981370 LENGTH 401 SQ:AASEQ MKYFSKSPEEWQKRDEEKEKEFRNRKNRIRRRANFILVVNLVIVVFLVFFTKAFFSNKPEGVIGPFQLVIETKESYLPNDPLDVRVKVFNREKKKENLVLEDFVFSIKRENDTVYEFHFPQRVEKEMEAFESVLVFDLLREEELSNLPGGNYTITVSVKLNGQRVVISKVVSVIEKWQIEVEDLKDFYFPYENVHFFVYLENISSKSRKIRVESIGLIILKGNEAVFERDIPIEKDFVINPMMVEQIHEVSFSAPKESGDYIIKLKLKTESSLIEKSIPLFVTREYQKDLKGLSLVIEGKKFVASGERYDFSVKLLNEEKKRKYIVLKNIMIVLTHKEPVFSYAYSEEYRMTIEGYSSREIFKTTSYDIIKLEDPGTYKLIVVIESEEDRLMKEMEIVVSE GT:EXON 1|1-401:0| TM:NTM 1 TM:REGION 33->55| NREPEAT 1 REPEAT 3|66->159|177->268|293->385| SEG 13->32|krdeekekefrnrknrirrr| SEG 34->50|nfilvvnlvivvflvff| SEG 165->176|vviskvvsviek| HM:PFM:NREP 2 HM:PFM:REP 145->162|PF07495|0.00046|50.0|18/66|Y_Y_Y| HM:PFM:REP 5->31|PF07544|0.00032|33.3|27/67|Med9| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-28| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEHHHHHHHHHHHHHHHHHccccccccccEEEEEEEHHHcccccccEEEEEEEccccHHccccHHHHHHHEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccEEHHHHHHHHHHHHcccHHHHHHHccccccEEEEEEEEcccccccEEEEEEEEEEEEEcccEEEEccccccccEEEcHHHHHHHHHHccccccccccEEEEEEEEccHHHHHccccEEEEEHHHHccccEEEEEEccEEEEccccEEEEEEEEcccccccEEEEEEEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEccEEEEEEcccccEEEEEEEEccHHHHHHHHHHHccc //