[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35944.1
DDBJ      :             glucose-1-phosphate thymidylyltransferase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  827/915 : Eukaryota  167/199 : Viruses  0/175   --->[See Alignment]
b.81.1c.68.1
:355 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->235 1h5sB PDBj 5e-46 38.7 %
:RPS:PDB   1->232 2e3dC PDBj 9e-64 32.8 %
:RPS:PDB   265->311 2eg0A PDBj 3e-04 14.9 %
:RPS:SCOP  2->235 1fxoA  c.68.1.6 * 1e-66 37.2 %
:RPS:SCOP  267->333 1fwyA1  b.81.1.4 * 1e-06 24.2 %
:HMM:SCOP  1->308 1fxoA_ c.68.1.6 * 3.9e-83 41.9 %
:RPS:PFM   4->217 PF00483 * NTP_transferase 1e-42 42.1 %
:RPS:PFM   251->310 PF07959 * Fucokinase 1e-04 28.3 %
:HMM:PFM   3->236 PF00483 * NTP_transferase 9.6e-62 32.9 234/248  
:HMM:PFM   237->318 PF07959 * Fucokinase 2.4e-06 20.8 77/413  
:BLT:SWISS 3->355 STRD_STRGR 2e-87 46.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35944.1 GT:GENE AAD35944.1 GT:PRODUCT glucose-1-phosphate thymidylyltransferase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(885985..887052) GB:FROM 885985 GB:TO 887052 GB:DIRECTION - GB:PRODUCT glucose-1-phosphate thymidylyltransferase GB:NOTE similar to PID:1001492 PID:1001590 percent identity: 71.27; identified by sequence similarity; putative GB:PROTEIN_ID AAD35944.1 GB:DB_XREF GI:4981396 LENGTH 355 SQ:AASEQ MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGENFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDPTRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKVRGYIVYGWWKDTGKPEDLLEANRKILMETTEELLGEMDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENCFIKNSYVGPYSSIGNRVILEDCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSQKRPASLNLILGNMSRVEL GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 3->355|STRD_STRGR|2e-87|46.2|351/355| SEG 236->247|lmetteellgem| BL:PDB:NREP 1 BL:PDB:REP 1->235|1h5sB|5e-46|38.7|235/291| RP:PDB:NREP 2 RP:PDB:REP 1->232|2e3dC|9e-64|32.8|229/288| RP:PDB:REP 265->311|2eg0A|3e-04|14.9|47/170| RP:PFM:NREP 2 RP:PFM:REP 4->217|PF00483|1e-42|42.1|214/238|NTP_transferase| RP:PFM:REP 251->310|PF07959|1e-04|28.3|60/394|Fucokinase| HM:PFM:NREP 2 HM:PFM:REP 3->236|PF00483|9.6e-62|32.9|234/248|NTP_transferase| HM:PFM:REP 237->318|PF07959|2.4e-06|20.8|77/413|Fucokinase| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00483|IPR005835| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF00483|IPR005835| RP:SCP:NREP 2 RP:SCP:REP 2->235|1fxoA|1e-66|37.2|234/292|c.68.1.6| RP:SCP:REP 267->333|1fwyA1|1e-06|24.2|66/77|b.81.1.4| HM:SCP:REP 1->308|1fxoA_|3.9e-83|41.9|289/0|c.68.1.6|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 3085 OP:NHOMOORG 1062 OP:PATTERN 43325287899889974433455276655646345223232325445767656265554453231122 3134333444443332222-2533222222233333245344431121-2224431111152-1233635311111114123534244543312111--31322133332--------------134333533436788783345353332354344322132343A4434223333223224343113222455656666567655664844476673551644222322593222222222222213222334233533333442264242332444444466644434434434434444444443444344433344444517633344454365466766512623522345576424432344323412-222211111212434322222111111111112-33343333342233332423354422323232323322-3333333333312521-----------------------------1123113111-54545635545336666665455843423323323122223322443244443334444333434352335241232322253454444322224132222113322321111111114211422442222244125445335554335365366--23333------22222443222332343-23322222322423333335232234332232322222323324333333231333333333343--212222222213442221131131111111122222333313322224253433333223322221222383221111125214333333323333331152334444-11-----1-3--------11--1---2211-----2243442343221 1111211-311-232121121222222112222222222222222222212222122112222111111122121111111-111-11----2---111113-2141142221222-111111121121342-111-1--11111-1---2--1131122222321-21352231211--1--112365-32--2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 354 STR:RPRED 99.7 SQ:SECSTR ccEEEEEcccccGGGTTGGGcccGGGcEETTEEHHHHHHHHHHHTTccEEEEEEEcGGGHHHHHHHcccHHHTcEEEEEEcTTcccHHHHHHTTHHHHccccEEEEcTTEEEcTTHHHHHHHHHHHccEEEEEEEEcccGGGcccEEcTTcEEcEEccccTTccccEEEEEEEEEcTTHHHHHHHccccGGGcccHHHHHHHHHHHcccEEEEEccccEEETTcHHHHHHHHHHHHHHHHHTTcEEccGGGEEccccEEcTTcEEccEEEETTcEEccccEEcccEEccccEEEEEEEcTTcEEccEEEEETcEEcccEEEcTTEEEcTTcEEEEEEEEccEETcEEEEEEEEE# DISOP:02AL 355-356| PSIPRED ccEEEEEcccccccccHHHccccccEEEEccEEHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHHcccccEEEEEccEEEEccHHHHHHHHHHccccEEEEEEEccccccccEEEEEccEEEEEEEccccccccEEEEEEEEEcHHHHHHHHHccccccccccHHHHHHHHHHccccEEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccEEccccEEEccEEEcccEEccccEEccEEEccccEEccccEEccEEEEEEEEccccEEccccEEEcccEEccccEEccccEEccccEEEEccccEEEc //