[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35951.1
DDBJ      :             thioredoxin reductase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  898/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.4.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->308 2q7vB PDBj 3e-63 43.8 %
:RPS:PDB   15->308 2a87A PDBj 1e-55 38.8 %
:RPS:SCOP  18->251 1cjcA2  c.4.1.1 * 5e-27 12.3 %
:RPS:SCOP  18->40,275->315 1xdiA1  c.3.1.5 * 1e-07 35.0 %
:HMM:SCOP  1->315 1f8rA1 c.3.1.2 * 1.1e-61 33.8 %
:RPS:PFM   19->290 PF07992 * Pyr_redox_2 1e-23 37.2 %
:HMM:PFM   19->292 PF07992 * Pyr_redox_2 1.2e-47 37.1 194/202  
:BLT:SWISS 18->316 TRXB_BACSU 6e-77 47.5 %
:PROS 147->167|PS00573|PYRIDINE_REDOX_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35951.1 GT:GENE AAD35951.1 GT:PRODUCT thioredoxin reductase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 890970..891923 GB:FROM 890970 GB:TO 891923 GB:DIRECTION + GB:PRODUCT thioredoxin reductase GB:NOTE similar to GB:Pyro_h percent identity: 67.62; identified by sequence similarity; putative GB:PROTEIN_ID AAD35951.1 GB:DB_XREF GI:4981404 LENGTH 317 SQ:AASEQ MVFFDTGSLKKKEIKDKYDIVVVGGGPAGLTSAIYARRAGLSVLVVEKAIEGGYVNLTHLVENYPGFPAISGEELASKFKEHAEKFGADIYNAEVVKLEVQGDKKVVELDDGKRIEAPVVIVATGANPKKLNVPGEKEFFGKGVSYCATCDGYLFAGKDVIVVGGGDSACDESIFLSNIVNKITMIQLLETLTAAKVLQERVLNNPKIEVIYNSTVREIRGKDKVEEVVIENVKTGETKVLKADGVFIFIGLDPNSKLLEGLVELDPYGYVITDENMETSVKGIYAVGDVRKKNLRQIVTAVADGAIAVEHAAKHYF GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 18->316|TRXB_BACSU|6e-77|47.5|297/316| PROS 147->167|PS00573|PYRIDINE_REDOX_2|PDOC00496| BL:PDB:NREP 1 BL:PDB:REP 18->308|2q7vB|3e-63|43.8|290/309| RP:PDB:NREP 1 RP:PDB:REP 15->308|2a87A|1e-55|38.8|294/313| RP:PFM:NREP 1 RP:PFM:REP 19->290|PF07992|1e-23|37.2|261/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 19->292|PF07992|1.2e-47|37.1|194/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 18->251|1cjcA2|5e-27|12.3|227/230|c.4.1.1| RP:SCP:REP 18->40,275->315|1xdiA1|1e-07|35.0|63/227|c.3.1.5| HM:SCP:REP 1->315|1f8rA1|1.1e-61|33.8|305/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 2546 OP:NHOMOORG 1130 OP:PATTERN 11131144444555562132222455312452132111111111222211121344154433232111 2341311222242311112-12112211111122222563242231121121433122--2233234241112222222213123-1-332213221-1324243434131111111111111112223242224411123111433-121112211122211-11423312122232122222323333134555555545464555448555445653373553333339734444444444444433233443222233222233222245424433334344333333323333333443434444444321333222544348555555544423553554343414135265252215437674231313422312222233432233424411111111112154245231234132214232321214211243131111111111111233212322223244432223333233332332323323313122212244343211112279222212446446523332243322433322321222111111111111132321113352384431111111221224213142211222222111111111122111112232223132122222322222242222331-2111111111122221212222222222-2232222222222222223222221122222112111222222122222221111111111111111-2111111111121121112111111-11114333423222223433232232232422211111111111113111112222234344442232222111233443311111111315----1-11121111112121111112213433224121 ----111----222322122111111111111121111111111111112112111111111111111-1221112212211111121-111211111111112211131253432112-112145-2-371-121-1--2122212-111-12-2212--1-21----21----1351-111424344132111---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 317 STR:RPRED 100.0 SQ:SECSTR ccccccEccccccEcccEEEEEEccHHHHHHHHHHHHHTTcccEEEcccccccGGGccccccccTTcTTccHHHHHHHHHHHHHHTTcEEEcccEEEEEcccccEEEEETTccEEEEEEEEEcccEEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccTTHHHHHHHcTTEEEEccEEEEEEEccccccEEEEEEETTcccEEEccccEEEcccEEEccTTTcTTcccTTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHcE DISOP:02AL 5-7| PSIPRED ccccccccccHHHHHccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEccccEEEEEEEEEEcccEEccccccccHHHccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEEEEEEEEEcEEEcHHHHHHHEEEccccEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccc //