[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35971.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y890_THEMA   RecName: Full=Putative zinc metalloprotease TM_0890;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  708/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
b.36.1
:501 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   125->192 3gdvC PDBj 1e-06 33.8 %
:RPS:PDB   125->182 3cs0A PDBj 2e-11 24.1 %
:RPS:SCOP  106->185 2i4sA1  b.36.1.5 * 3e-09 15.0 %
:HMM:SCOP  125->190 1lcyA1 b.36.1.4 * 1.6e-15 34.8 %
:RPS:PFM   6->138 PF02163 * Peptidase_M50 9e-28 42.4 %
:RPS:PFM   125->151 PF00595 * PDZ 6e-05 55.6 %
:HMM:PFM   5->494 PF02163 * Peptidase_M50 7.8e-68 44.8 192/193  
:BLT:SWISS 1->501 Y890_THEMA 0.0 100.0 %
:PROS 14->23|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35971.1 GT:GENE AAD35971.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 912493..913998 GB:FROM 912493 GB:TO 913998 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AL009126 percent identity: 59.04; identified by sequence similarity; putative GB:PROTEIN_ID AAD35971.1 GB:DB_XREF GI:4981425 LENGTH 501 SQ:AASEQ MVIVYFILILTGVIMVHELGHYLFARLFKVKVLEFAIGFGPKIFSVKGRETTFRLNVFPIGGYVRMLGEEGEEIADEEEKEKSFYAKPAWQRFLITLAGPLFSILAGYLLFLPITLNWGIALPGIDEVVPGSPAEEAGLRRGDIIYSINDKIAFDTSIISNEIQKGLPVELVIIRNGEKKSLRLTPRMYPETYEFVLESAEGTPSGKLVSVNGNRDTSVLKEFVNEYVVLEFEGGTVKGILKQFNEIPARYMIGISFSGLAPVFKKDIYFKEGLFVFKKGDRIVRVEDQEIEGWQDLVVLYQRLTLGKDTMIVSLQGENIEWWRGLSGSVRVVIKRGDSTIEKNVEASFLKNILETPDLLEMGVPRYKPKNPLEAVNLSVKACNYVLLTTASSLKNFFRNVQTGQIVGVVGLAGVISAASKTGLEAVLTVVAVITISLGVLNLLPLPALDGGRIIFSLVEMITRKKLNPQVENIIHFLGFIFLMILFLYITFLDIGRMMGI GT:EXON 1|1-501:0| SW:ID Y890_THEMA SW:DE RecName: Full=Putative zinc metalloprotease TM_0890; EC=3.4.24.-; SW:GN OrderedLocusNames=TM_0890; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Hydrolase;Membrane; Metal-binding; Metalloprotease; Protease; Transmembrane;Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->501|Y890_THEMA|0.0|100.0|501/501| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 14->23|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 6 TM:REGION 1->23| TM:REGION 25->47| TM:REGION 98->120| TM:REGION 400->422| TM:REGION 433->455| TM:REGION 474->496| SEG 69->81|eegeeiadeeeke| SEG 438->452|lgvlnllplpaldgg| SEG 474->493|iihflgfiflmilflyitfl| BL:PDB:NREP 1 BL:PDB:REP 125->192|3gdvC|1e-06|33.8|68/293| RP:PDB:NREP 1 RP:PDB:REP 125->182|3cs0A|2e-11|24.1|58/379| RP:PFM:NREP 2 RP:PFM:REP 6->138|PF02163|9e-28|42.4|132/331|Peptidase_M50| RP:PFM:REP 125->151|PF00595|6e-05|55.6|27/82|PDZ| HM:PFM:NREP 1 HM:PFM:REP 5->494|PF02163|7.8e-68|44.8|192/193|Peptidase_M50| GO:PFM:NREP 3 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| GO:PFM GO:0005515|"GO:protein binding"|PF00595|IPR001478| RP:SCP:NREP 1 RP:SCP:REP 106->185|2i4sA1|3e-09|15.0|80/102|b.36.1.5| HM:SCP:REP 125->190|1lcyA1|1.6e-15|34.8|66/100|b.36.1.4|1/2|PDZ domain-like| OP:NHOMO 750 OP:NHOMOORG 723 OP:PATTERN -------------------------------------------------------------------- -111111111111-11111-111111111111111111111--11-11-111111--111---1111111------------111111111111111--111111111111111111-1111111111221111111111111111111-1111111------111111--1--1111-111111111111-1111111-11111111111111111111111111111111111111111--11111111111---11-1-----111111111-------1-1-11111111111111-------------1--111---1111111111111111111111211111-1-1111111111111111111--1-111--1111111111111111111111111111-11112111111111111111111-111111111111111--------1111-1-1111111111111111111111111111111-111-111111111111111111111111111111111111111-1111111111111111-11111111111111111111111111111111111112222222111111111111-111-1-11111111111111111111111111111111111111111-11111-------1111-1---------------------------------11--11-111111111111111-------1-1111111111111111111--2222-11111111111-11111111111111111-111111--1-1111-111---------11111111111111111111111111111111-11----111111111------1-------------1------111111111111- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------11117111-13--2-311------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 17.0 SQ:SECSTR ###############################################################################################################ccEEEEEEccEEEEcccccccTTGGGTccTTcEEccccccccccHHHHHHHHHTccccEEEEEETTEEEEEcccccEEcTTEEcc################################################################################################################################################################################################################################################################################################################# DISOP:02AL 67-83, 189-218, 327-349| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccEEEEEEcccEEEEEEEEEEccEEEcccccccccccccHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHccccEEEEEEEccEEEEEEEEEEEccccccccccccccccccccccccccccccccHHHccHHccccccccEEEcEEcccccccccccccccccEEEEEccccHHHHHHHcccccccEEEEEccEEEccHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEcccEEEEEEccccEEccEEEEEEEEEEcccccEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //