[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35972.1
DDBJ      :             gcpE protein
Swiss-Prot:ISPG_THEMA   RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase;         EC=1.17.7.1;AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;

Homologs  Archaea  0/68 : Bacteria  736/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
c.1.21d.134.1
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->209 2nxiI PDBj 7e-04 24.2 %
:RPS:PDB   16->292 3e59B PDBj 8e-32 12.5 %
:RPS:SCOP  28->242 1q7mA1  c.1.21.2 * 3e-14 10.7 %
:RPS:SCOP  245->344 1aopA4  d.134.1.1 * 2e-07 21.2 %
:HMM:SCOP  4->191 1q7zA1 c.1.21.2 * 1.1e-09 20.3 %
:HMM:SCOP  245->344 1aopA4 d.134.1.1 * 1e-09 34.0 %
:RPS:PFM   17->337 PF04551 * GcpE 6e-63 46.7 %
:HMM:PFM   3->336 PF04551 * GcpE 3.2e-127 50.5 333/359  
:BLT:SWISS 15->344 ISPG_THEMA 0.0 100.0 %
:REPEAT 2|19->128|129->247
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35972.1 GT:GENE AAD35972.1 GT:PRODUCT gcpE protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 913995..915029 GB:FROM 913995 GB:TO 915029 GB:DIRECTION + GB:PRODUCT gcpE protein GB:NOTE similar to SP:P54482 PID:1303846 GB:AL009126 percent identity: 71.05; identified by sequence similarity; putative GB:PROTEIN_ID AAD35972.1 GB:DB_XREF GI:4981426 LENGTH 344 SQ:AASEQ MRKSVKVGKVVIGGEAPVSVQSMTTTKTADVEKTVSQIKSLERAGCEIVRVAVQDEEDAKAIRRIKEQIEIPLVADIQFDYRLAILSIENGADKIRINPGNMSRDRLKDVVAAAKGKGIPIRVGANVGSIKRRTSERWKDLAESALEEVRLLEKEGFYDIIVSVKSSDVLETIKANEYIAEKVEYPIHLGVTEAGVSETAIVKSSIAIGHLLLKNIGDTIRVSISGDPVREVIVGKKILIALGLREGVEVIACPTCGRAEIDVENMAKMIEENFFHVQKRLKIAVMGCVVNGIGEGKDADLGVAGLRDGAVIFVKGEIKERVSKEFVLERLKYYLNELLEEVER GT:EXON 1|1-344:0| SW:ID ISPG_THEMA SW:DE RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; EC=1.17.7.1;AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase; SW:GN Name=ispG; OrderedLocusNames=TM_0891; SW:KW 4Fe-4S; Complete proteome; Iron; Iron-sulfur; Isoprene biosynthesis;Metal-binding; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 15->344|ISPG_THEMA|0.0|100.0|330/344| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| NREPEAT 1 REPEAT 2|19->128|129->247| SEG 3->14|ksvkvgkvvigg| BL:PDB:NREP 1 BL:PDB:REP 56->209|2nxiI|7e-04|24.2|149/262| RP:PDB:NREP 1 RP:PDB:REP 16->292|3e59B|8e-32|12.5|264/305| RP:PFM:NREP 1 RP:PFM:REP 17->337|PF04551|6e-63|46.7|319/353|GcpE| HM:PFM:NREP 1 HM:PFM:REP 3->336|PF04551|3.2e-127|50.5|333/359|GcpE| GO:PFM:NREP 3 GO:PFM GO:0016114|"GO:terpenoid biosynthetic process"|PF04551|IPR004588| GO:PFM GO:0046429|"GO:4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity"|PF04551|IPR004588| GO:PFM GO:0055114|"GO:oxidation reduction"|PF04551|IPR004588| RP:SCP:NREP 2 RP:SCP:REP 28->242|1q7mA1|3e-14|10.7|214/259|c.1.21.2| RP:SCP:REP 245->344|1aopA4|2e-07|21.2|99/145|d.134.1.1| HM:SCP:REP 4->191|1q7zA1|1.1e-09|20.3|182/0|c.1.21.2|1/1|Dihydropteroate synthetase-like| HM:SCP:REP 245->344|1aopA4|1e-09|34.0|97/145|d.134.1.1|1/1|Sulfite reductase hemoprotein (SiRHP), domains 2 and 4| OP:NHOMO 788 OP:NHOMOORG 761 OP:PATTERN -------------------------------------------------------------------- 111121111111-111111-1111211111111111111111111111111111111111111111122111111111111111111111111111---------1111111111111111111111111111111-----111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11-111--111-----------------------------------------------------------------------------------------1111111111111111111111111111111111111111111111111-111111111111111111111111111111111111-11111111111-11111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111211111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-111---------1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111--------11------------1------1------1111111111111 11------1---------------------------------------------------------------------------------------------------3-------------------------------------------------1---------------11111F111113122-2111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 85.5 SQ:SECSTR ##############TTccccccHHHHHHHHHHHHHHHHHHTccEEEEEcccccccccTTTcccccccHHHHHHHHHHHHHHHHHHTTcTTcEEEEEEccHHHHGGGGTccHHHHHHHHHHHHHHHHHTTcTTEEEEcGGGcGGGGGHHHHHHHHHcccHHHHHHHHTTcHHHHHHHHHHHHHHHHHccTTccccHHHHHHHHHHHHHHHHHHHHHcTTcEEEEcccccTTccEEEccccTTcccccGGGcEEEEETTEEEEEcHHHHHHTTcEEEEHHHHHTTTcEEEEETTTTcGGGccEEEEEEEE#################################### DISOP:02AL 344-345| PSIPRED ccccEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHHccccEEEEEcccccccccEEEHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEccccccHHccEEEEccccccEEEEccEEEEEccHHHHHHHHHHHHHHHHHHHcc //