[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35981.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->83 PF04230 * PS_pyruv_trans 0.00017 31.2 48/270  
:BLT:SWISS 73->153 RU2A_DEBHA 3e-04 38.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35981.1 GT:GENE AAD35981.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(920657..921139) GB:FROM 920657 GB:TO 921139 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35981.1 GB:DB_XREF GI:4981436 LENGTH 160 SQ:AASEQ MTIAYLDSRKIEGKFIGGLLSVDERGIPVEFKYTDPVVPNELQKILYGSSIDTYLKGELIAKTLLKKMEKKPDFVFVRDPELLEVDDRLLLIVERTEKVETPTRVSEEEVLLPFKGSSVKIVGKISDEDMKKLADLLETFDVMEPFQRLERALEYLCSEK GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 73->153|RU2A_DEBHA|3e-04|38.7|75/238| HM:PFM:NREP 1 HM:PFM:REP 34->83|PF04230|0.00017|31.2|48/270|PS_pyruv_trans| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7| PSIPRED cEEEEEcccccccEEEEEEEEEccccEEEEEEEcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHEEcccEEEEEEEccccccccEEEHEEEEEEEcccEEEEEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccc //