[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35983.1
DDBJ      :             RNA polymerase sigma-28 factor, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  519/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13b.52.2
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->200 1rp3E PDBj 2e-24 31.8 %
:RPS:PDB   34->113 1aw8E PDBj 2e-13 11.2 %
:RPS:PDB   157->200 2dk5A PDBj 2e-05 13.6 %
:RPS:SCOP  4->113 1aw8.1  b.52.2.1 * 9e-16 11.9 %
:RPS:SCOP  132->200 1iw7F2  a.4.13.2 * 7e-09 33.8 %
:HMM:SCOP  4->78 1rp3A3 a.177.1.1 * 4.7e-15 38.7 %
:HMM:SCOP  79->148 1rp3A1 a.4.13.1 * 0.00043 34.3 %
:HMM:SCOP  148->216 1ttyA_ a.4.13.2 * 8.8e-17 46.4 %
:RPS:PFM   7->75 PF04542 * Sigma70_r2 3e-07 33.3 %
:RPS:PFM   161->198 PF08281 * Sigma70_r4_2 5e-04 47.4 %
:HMM:PFM   162->211 PF04545 * Sigma70_r4 3e-19 46.0 50/50  
:HMM:PFM   8->78 PF04542 * Sigma70_r2 7.1e-18 29.4 68/71  
:HMM:PFM   96->137 PF04539 * Sigma70_r3 0.00017 23.8 42/78  
:BLT:SWISS 3->200 FLIA_ECOLI 9e-30 37.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35983.1 GT:GENE AAD35983.1 GT:PRODUCT RNA polymerase sigma-28 factor, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(921425..922087) GB:FROM 921425 GB:TO 922087 GB:DIRECTION - GB:PRODUCT RNA polymerase sigma-28 factor, putative GB:NOTE similar to PID:1419613 percent identity: 61.11; identified by sequence similarity; putative GB:PROTEIN_ID AAD35983.1 GB:DB_XREF GI:4981438 LENGTH 220 SQ:AASEQ MWNKESVIRSLLPFIKRIAEDLAQTLPPNVEVDDLIQEGIVAALSSLERYDPSKASFTTFIMKRVKGAMYDYLRKIDWMPRNLRKNVKMIERVIYESEEFPSDEEIARKTGLELKEVVRARNEMMRKQLLMIDAMEDEIVLKTEGPDENAYRELLVEEMKKAIEKLSDKEKLVLSLRFEKGLSLKEIARVLGVSESRVSQIISKSLLKIKKEVMGDDQAG GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 3->200|FLIA_ECOLI|9e-30|37.9|198/239| SEG 201->211|iisksllkikk| BL:PDB:NREP 1 BL:PDB:REP 4->200|1rp3E|2e-24|31.8|195/235| RP:PDB:NREP 2 RP:PDB:REP 34->113|1aw8E|2e-13|11.2|80/90| RP:PDB:REP 157->200|2dk5A|2e-05|13.6|44/91| RP:PFM:NREP 2 RP:PFM:REP 7->75|PF04542|3e-07|33.3|66/70|Sigma70_r2| RP:PFM:REP 161->198|PF08281|5e-04|47.4|38/54|Sigma70_r4_2| HM:PFM:NREP 3 HM:PFM:REP 162->211|PF04545|3e-19|46.0|50/50|Sigma70_r4| HM:PFM:REP 8->78|PF04542|7.1e-18|29.4|68/71|Sigma70_r2| HM:PFM:REP 96->137|PF04539|0.00017|23.8|42/78|Sigma70_r3| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 4->113|1aw8.1|9e-16|11.9|109/115|b.52.2.1| RP:SCP:REP 132->200|1iw7F2|7e-09|33.8|65/100|a.4.13.2| HM:SCP:REP 4->78|1rp3A3|4.7e-15|38.7|75/87|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 79->148|1rp3A1|0.00043|34.3|70/0|a.4.13.1|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| HM:SCP:REP 148->216|1ttyA_|8.8e-17|46.4|69/0|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 736 OP:NHOMOORG 524 OP:PATTERN -------------------------------------------------------------------- 11211---------1------3----------1---11112-1-2--121-1----------6-321333------------421323--------------------1-11111111111111---------------11---22121111-21---------11----1-----------------11-23533333333233333335554533335522221111115311111111111111122211------------------1-------1111111111111111111111111111111111111111111142233222222222222223111222112112222223223222235---111------------------------------------------------------------------1111--------------------------------------------------11-111-111111211111111111112121111111--111121111--111111211111-------111-11111-1111111111-111111111----1-11-111-1111111111111111111---12-1111111-1211121211121122221---1111------21111111111111111-1211211111112-11--1---11111111111111111111111-1--1111121222121221---------1111--111-------------------------1111111111211111111---------1111211111221111111111112------111111111111111111--------------------------212221111111- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------245-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 89.5 SQ:SECSTR ###HHHHHHHTHHHHHHHHGGGccTccccEEEEHHHHHHTccTTcEEEEEETTTcEEEEEcEEEcTTcccEEccGGGGGTccTTccEEEEccccccHHHHcccccEETTTEEcHHHHHcTTccHHHHHHHHHHccTTcccccGccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHTTccTTcHHHHHHHTTcccHHHHHH#################### DISOP:02AL 214-220| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc //