[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35991.1
DDBJ      :             flagellar biosynthesis protein FliR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->215 PF01311 * Bac_export_1 5e-14 30.0 %
:HMM:PFM   15->244 PF01311 * Bac_export_1 8.5e-40 26.1 230/249  
:BLT:SWISS 14->216 FLIR_BACSU 3e-18 28.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35991.1 GT:GENE AAD35991.1 GT:PRODUCT flagellar biosynthesis protein FliR GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(928881..929657) GB:FROM 928881 GB:TO 929657 GB:DIRECTION - GB:PRODUCT flagellar biosynthesis protein FliR GB:NOTE similar to SP:P35537 GB:X74122 PID:395392 GB:AL009126 percent identity: 55.87; identified by sequence similarity; putative GB:PROTEIN_ID AAD35991.1 GB:DB_XREF GI:4981446 LENGTH 258 SQ:AASEQ MILETIFSFLEEKFLAWMCIFTRFTGFFLIAPFFSERAFPVVVRVLLGLFTSWLMLFTVDVSIPLNTPVLSFTLNLFFNFLVGFGIGFIVYLFLQAFNGAGYIFGFQIGFGMEEVLAFGEEETNPTGELVYFIALTVFVLIKGPVLLFEGLKDSIDVFPVNLTGVTDGFFSYIVGRSSDFFVLILKIGAPVIAFMLIISIVLGIVSRLIPQMNVFMVGLPLKVIIGVILILGMLPIWADMAQKISALSWNAIQELLGK GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 14->216|FLIR_BACSU|3e-18|28.3|198/259| TM:NTM 6 TM:REGION 14->36| TM:REGION 40->62| TM:REGION 73->95| TM:REGION 128->150| TM:REGION 182->204| TM:REGION 215->237| SEG 74->90|lnlffnflvgfgigfiv| SEG 217->236|vglplkviigvililgmlpi| RP:PFM:NREP 1 RP:PFM:REP 10->215|PF01311|5e-14|30.0|203/245|Bac_export_1| HM:PFM:NREP 1 HM:PFM:REP 15->244|PF01311|8.5e-40|26.1|230/249|Bac_export_1| GO:PFM:NREP 2 GO:PFM GO:0006605|"GO:protein targeting"|PF01311|IPR002010| GO:PFM GO:0016020|"GO:membrane"|PF01311|IPR002010| OP:NHOMO 82 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------1---------------------1-----------------------------------------------------------------------------------11----------------11111------11--------11------------------------------------------------------------------------------------------1111-1111---1--1-------111---11-111111111--1111--------------------------------------------------1-------------------------------------------1----------------------------------------------------------------------11---111---1-------------------------11-----1-111111111111-1------1--------------------------------1------1----1------1----------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------11----------------------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-121| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //