[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36002.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  248/915 : Eukaryota  1/199 : Viruses  1/175   --->[See Alignment]
d.2.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->121 1qsaA PDBj 4e-08 34.3 %
:RPS:PDB   23->135 132lA PDBj 4e-19 11.7 %
:RPS:SCOP  36->151 1qsaA2  d.2.1.6 * 2e-17 30.2 %
:HMM:SCOP  24->152 1qsaA2 d.2.1.6 * 5.2e-31 43.4 %
:RPS:PFM   39->121 PF01464 * SLT 2e-12 47.0 %
:HMM:PFM   33->132 PF01464 * SLT 9e-28 39.0 100/121  
:BLT:SWISS 37->144 YJBJ_BACSU 5e-13 40.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36002.1 GT:GENE AAD36002.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 939389..939853 GB:FROM 939389 GB:TO 939853 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36002.1 GB:DB_XREF GI:4981458 LENGTH 154 SQ:AASEQ MRSFFLCFLLVLVFIANLYRLFPDDYYDFISKNSDDLDPLLIQSIIWVESSFDRNAVSSLGAFGLMQIMPSTAVWLKKKFSLEEDFKNPEGNIIYGIVYLKFLKDLYGDLDKAIMAYNVGPAALSEGRNLDSAKRYLKKVKRTYLIYRFLYSER GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 37->144|YJBJ_BACSU|5e-13|40.8|103/181| TM:NTM 1 TM:REGION 2->24| SEG 4->14|fflcfllvlvf| BL:PDB:NREP 1 BL:PDB:REP 17->121|1qsaA|4e-08|34.3|105/618| RP:PDB:NREP 1 RP:PDB:REP 23->135|132lA|4e-19|11.7|111/124| RP:PFM:NREP 1 RP:PFM:REP 39->121|PF01464|2e-12|47.0|83/113|SLT| HM:PFM:NREP 1 HM:PFM:REP 33->132|PF01464|9e-28|39.0|100/121|SLT| RP:SCP:NREP 1 RP:SCP:REP 36->151|1qsaA2|2e-17|30.2|116/168|d.2.1.6| HM:SCP:REP 24->152|1qsaA2|5.2e-31|43.4|129/168|d.2.1.6|1/1|Lysozyme-like| OP:NHOMO 377 OP:NHOMOORG 250 OP:PATTERN -------------------------------------------------------------------- -32-------------------------------------------------1-1---------------------------1112------------------------------------------------------1---12111111111-------111111111--------------------111---------------2111-2---111----------22------------------------------------------------------------------------------------------23122222222212222221111-21112--22221222-1322222---12-1--2-------1-4-1311--1----------1-------1-312-------------15-----4-----1---------154-2---11----------------------------31131-----------------------------1222-1112-13222211211-1-11212-------111--12111112--4-222123222222322224132------------------------------11-1---11-11111111111112111--1--11----------1---------------------------------------------------------------------------------1---------11------------------11111----1-2----1-1--1111----2--------11--------11111----------------2122111111111111----------------------------2--1222222--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 134 STR:RPRED 87.0 SQ:SECSTR ##############HcccccHHHHHHHHHHHTTcTTTccHHHHHHHHHHHTTcTTcEEccEEETTTTEETTTTccccccTTcccTTcccGGGGGccccHHHHHHHHHHHTccGGGGcHHHHHHTccTccGGGGGTHHHHHTTcTHHHH###### DISOP:02AL 153-154| PSIPRED cHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccc //