[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36007.1
DDBJ      :             chromosomal replication initiator protein
Swiss-Prot:DNAA_THEMA   RecName: Full=Chromosomal replication initiator protein dnaA;

Homologs  Archaea  0/68 : Bacteria  903/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.12c.37.1
:440 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   96->335 2z4rA PDBj e-138 100.0 %
:RPS:PDB   3->69 2e0gA PDBj 2e-09 16.7 %
:RPS:PDB   86->312 3bq9A PDBj 2e-27 10.7 %
:RPS:SCOP  98->306 1l8qA2  c.37.1.20 * 6e-36 47.5 %
:RPS:SCOP  344->434 1j1vA  a.4.12.2 * 2e-12 18.7 %
:HMM:SCOP  96->312 1l8qA2 c.37.1.20 * 9.4e-46 27.4 %
:HMM:SCOP  327->435 1l8qA1 a.4.12.2 * 1.5e-16 33.0 %
:RPS:PFM   100->312 PF00308 * Bac_DnaA 1e-68 56.1 %
:HMM:PFM   98->315 PF00308 * Bac_DnaA 1.9e-96 56.7 217/219  
:HMM:PFM   344->411 PF08299 * Bac_DnaA_C 1.9e-25 38.2 68/70  
:BLT:SWISS 1->440 DNAA_THEMA 0.0 100.0 %
:PROS 393->411|PS01008|DNAA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36007.1 GT:GENE AAD36007.1 GT:PRODUCT chromosomal replication initiator protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(944250..945572) GB:FROM 944250 GB:TO 945572 GB:DIRECTION - GB:PRODUCT chromosomal replication initiator protein GB:NOTE similar to SP:P46798 PID:780792 GB:AE000512 percent identity: 100.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36007.1 GB:DB_XREF GI:4981463 LENGTH 440 SQ:AASEQ MKERILQEIKTRVNRKSWELWFSSFDVKSIEGNKVVFSVGNLFIKEWLEKKYYSVLSKAVKVVLGNDATFEITYEAFEPHSSYSEPLVKKRAVLLTPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYVVQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKEVDLKEAILLLKDFIKPNRVKAMDPIDELIEIVAKVTGVPREEILSNSRNVKALTARRIGMYVAKNYLKSSLRTIAEKFNRSHPVVVDSVKKVKDSLLKGNKQLKALIDEVIGEISRRALSG GT:EXON 1|1-440:0| SW:ID DNAA_THEMA SW:DE RecName: Full=Chromosomal replication initiator protein dnaA; SW:GN Name=dnaA; OrderedLocusNames=TM_0926; SW:KW 3D-structure; ATP-binding; Complete proteome; Cytoplasm;DNA replication; DNA-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->440|DNAA_THEMA|0.0|100.0|440/440| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 393->411|PS01008|DNAA|PDOC00771| SEG 403->417|vvvdsvkkvkdsllk| BL:PDB:NREP 1 BL:PDB:REP 96->335|2z4rA|e-138|100.0|240/240| RP:PDB:NREP 2 RP:PDB:REP 3->69|2e0gA|2e-09|16.7|66/107| RP:PDB:REP 86->312|3bq9A|2e-27|10.7|215/446| RP:PFM:NREP 1 RP:PFM:REP 100->312|PF00308|1e-68|56.1|212/218|Bac_DnaA| HM:PFM:NREP 2 HM:PFM:REP 98->315|PF00308|1.9e-96|56.7|217/219|Bac_DnaA| HM:PFM:REP 344->411|PF08299|1.9e-25|38.2|68/70|Bac_DnaA_C| RP:SCP:NREP 2 RP:SCP:REP 98->306|1l8qA2|6e-36|47.5|204/213|c.37.1.20| RP:SCP:REP 344->434|1j1vA|2e-12|18.7|91/94|a.4.12.2| HM:SCP:REP 96->312|1l8qA2|9.4e-46|27.4|212/213|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 327->435|1l8qA1|1.5e-16|33.0|106/0|a.4.12.2|1/1|TrpR-like| OP:NHOMO 1049 OP:NHOMOORG 905 OP:PATTERN -------------------------------------------------------------------- 1111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111122222222222222222111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111-1212111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222222222222212221111111111111111111111111111111111111111111111111111121111111111111--1111111111122222212221222222-2212222222222222222222222222222222222222222122222221-222222222222--2211111111121121222222121212111111111111111222212221222112221111111111111111111111111111111111111111211111111111111111111111-111111111111111-1111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 381 STR:RPRED 86.6 SQ:SECSTR ##HHHHHHHHHHccccHHHHTTTTcEEEE#cccEEEEEEccHHHHHHHHHTHHHHHHHHHHHHTccccc################ccHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHTcGGGcTTccccEEEEEcGGGHHHHHHHHHHHHHHTcTTGGGcEEEEccHHHHHHHHHHHHHHHHHHHHHGGccEEETTccccccccccccGGGTccccccHHHHHTccccTTccHHHHTccHHHHHHHHHHHHHHHHcHHHHHHHHHHccEEEEccHcHHHHHHHHHHHHHHHTTccccTTccccccEEHHHTcccHHHHHHcccccTTHHHHHHTTcccHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHTccHHHHHH######################################## DISOP:02AL 78-97, 336-342, 417-418, 437-440| PSIPRED cHHHHHHHHHHHccHHHHHHHHHccEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHEEEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHcccHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccc //