[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36060.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.114.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->89 2hy5A PDBj 3e-10 31.5 %
:RPS:PDB   1->107 2d1pA PDBj 8e-23 18.7 %
:RPS:SCOP  2->116 1jx7A  c.114.1.1 * 4e-36 33.6 %
:HMM:SCOP  1->116 2hy5A1 c.114.1.1 * 4.2e-29 36.2 %
:RPS:PFM   20->114 PF02635 * DrsE 4e-10 37.2 %
:HMM:PFM   1->115 PF02635 * DrsE 7.8e-22 31.9 113/119  
:BLT:SWISS 1->89 DSRE_CHRVI 9e-10 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36060.1 GT:GENE AAD36060.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(992051..992407) GB:FROM 992051 GB:TO 992407 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to PID:1772578 percent identity: 50.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36060.1 GB:DB_XREF GI:4981520 LENGTH 118 SQ:AASEQ MKIGIQVMVPPYTYEDLDTAIKIAEAAMEKGHEVTLFLFADSVICTNKNIKPIKIDRNIPQKLVELMQKGNFEVHICGICMDYRGITTDMIIEGSKPSGLPELANLIATCDRFINLMA GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 1->89|DSRE_CHRVI|9e-10|31.5|89/130| BL:PDB:NREP 1 BL:PDB:REP 1->89|2hy5A|3e-10|31.5|89/130| RP:PDB:NREP 1 RP:PDB:REP 1->107|2d1pA|8e-23|18.7|107/130| RP:PFM:NREP 1 RP:PFM:REP 20->114|PF02635|4e-10|37.2|94/110|DrsE| HM:PFM:NREP 1 HM:PFM:REP 1->115|PF02635|7.8e-22|31.9|113/119|DrsE| RP:SCP:NREP 1 RP:SCP:REP 2->116|1jx7A|4e-36|33.6|113/117|c.114.1.1| HM:SCP:REP 1->116|2hy5A1|4.2e-29|36.2|116/0|c.114.1.1|1/1|DsrEFH-like| OP:NHOMO 25 OP:NHOMOORG 24 OP:PATTERN -------------------------------------1------------------------------ ------------------------------------------------------------------------------------------------------------------------------1111111-------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------211-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 97.5 SQ:SECSTR cEEEEEEccccccccHHHHHHHHHHHHHHTTcEEEEEEcGGGGGGGcTTccccTTcccHHHHHHHHHHHHccEEEEEHHHHHHTTcccHHHHHHHTcccccccTTEETTccEEEE### DISOP:02AL 118-119| PSIPRED cEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHcccccccccccHHHHHHHHHHHcccEEEEEHHHHHHccccHHHccccEEEccHHHHHHHHHHcccEEEEcc //