[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36062.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y983_THEMA   RecName: Full=UPF0033 protein TM_0983;

Homologs  Archaea  11/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.3
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->79 1jdqA PDBj 8e-44 100.0 %
:RPS:PDB   1->77 1dcjA PDBj 9e-18 28.9 %
:RPS:SCOP  1->79 1jdqA  d.68.3.3 * 1e-14 100.0 %
:HMM:SCOP  1->78 1je3A_ d.68.3.3 * 1.7e-24 48.1 %
:RPS:PFM   9->66 PF01206 * SirA 3e-11 51.7 %
:HMM:PFM   8->77 PF01206 * SirA 3.2e-26 47.8 69/70  
:BLT:SWISS 1->79 Y983_THEMA 2e-43 100.0 %
:PROS 10->34|PS01148|UPF0033

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36062.1 GT:GENE AAD36062.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(993444..993683) GB:FROM 993444 GB:TO 993683 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000782 percent identity: 66.23; identified by sequence similarity; putative GB:PROTEIN_ID AAD36062.1 GB:DB_XREF GI:4981522 LENGTH 79 SQ:AASEQ MAKYQVTKTLDVRGEVCPVPDVETKRALQNMKPGEILEVWIDYPMSKERIPETVKKLGHEVLEIEEVGPSEWKIYIKVK GT:EXON 1|1-79:0| SW:ID Y983_THEMA SW:DE RecName: Full=UPF0033 protein TM_0983; SW:GN OrderedLocusNames=TM_0983; SW:KW 3D-structure; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|Y983_THEMA|2e-43|100.0|79/79| PROS 10->34|PS01148|UPF0033|PDOC00884| BL:PDB:NREP 1 BL:PDB:REP 1->79|1jdqA|8e-44|100.0|79/98| RP:PDB:NREP 1 RP:PDB:REP 1->77|1dcjA|9e-18|28.9|76/81| RP:PFM:NREP 1 RP:PFM:REP 9->66|PF01206|3e-11|51.7|58/70|SirA| HM:PFM:NREP 1 HM:PFM:REP 8->77|PF01206|3.2e-26|47.8|69/70|SirA| GO:PFM:NREP 4 GO:PFM GO:0005515|"GO:protein binding"|PF01206|IPR001455| GO:PFM GO:0005737|"GO:cytoplasm"|PF01206|IPR001455| GO:PFM GO:0008033|"GO:tRNA processing"|PF01206|IPR001455| GO:PFM GO:0016783|"GO:sulfurtransferase activity"|PF01206|IPR001455| RP:SCP:NREP 1 RP:SCP:REP 1->79|1jdqA|1e-14|100.0|79/98|d.68.3.3| HM:SCP:REP 1->78|1je3A_|1.7e-24|48.1|77/97|d.68.3.3|1/1|SirA-like| OP:NHOMO 70 OP:NHOMOORG 63 OP:PATTERN ------11----------111--1-------------------------11111-------------- -----------------------------------------------1------------------------------------1111----------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------2111-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1--1-111121-1---------------------------111--1111--1-------------------1---1--------------------------------------1----------------1---------111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------22222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 100.0 SQ:SECSTR cccccccEEEccTTccTTHHHHHHHHHHHHccTTccEEEEEccTTHHHHHHHHHHHTTcEEEEEEccccccEEEEEEcc DISOP:02AL 1-2| PSIPRED cccccccEEEccccccccHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHccEEEEEEEccccEEEEEEEEc //