[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36064.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->87 PF10026 * DUF2268 4.8e-05 26.7 60/195  
:PROS 76->85|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36064.1 GT:GENE AAD36064.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 998480..998923 GB:FROM 998480 GB:TO 998923 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36064.1 GB:DB_XREF GI:4981524 LENGTH 147 SQ:AASEQ MINLELGKDFLDRFTKVCEFLRVEPSLDVVVFECESLEEFHEITGMPYHTGGVYHEGVIYTQPLDVLRRKNSLEATILHELLHHVLEMYFDLPRWMEEGVVLAVLGVKPEEVFGYHRDCLLRFMEKVRYEEIPDLVDRYRRSSVERR GT:EXON 1|1-147:0| PROS 76->85|PS00142|ZINC_PROTEASE|PDOC00129| HM:PFM:NREP 1 HM:PFM:REP 25->87|PF10026|4.8e-05|26.7|60/195|DUF2268| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 142-147| PSIPRED cccHHHcHHHHHHHHHHHHHHHccccccEEEEEHHHHHHHHHHcccccccccEEEccEEEEccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccc //