[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36070.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:584 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->230 PF03235 * DUF262 3e-17 31.6 %
:RPS:PFM   263->554 PF09854 * DUF2081 6e-29 36.8 %
:HMM:PFM   237->580 PF09854 * DUF2081 3e-79 30.7 306/312  
:HMM:PFM   14->226 PF03235 * DUF262 1.6e-35 25.0 192/224  
:BLT:SWISS 16->533 Y686_METJA 3e-14 28.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36070.1 GT:GENE AAD36070.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1009825..1011579) GB:FROM 1009825 GB:TO 1011579 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36070.1 GB:DB_XREF GI:4981531 LENGTH 584 SQ:AASEQ MNGLLFKKVDYSVGGLLENIDSGEIGLPDIQRPFVWDTTRVRDLFDSMYRGYPIGTLLFWENGFPGEHRTIGTGPKKKVPRLLVVDGQQRLTALYSVMKGVPIVDKNFRQRRLRIAFNPLEEKFEVTNTSIERDPTWISDISILWQEGFALYDFISSFMKRLEERRGLTEEERQRIPRSIQKLVNLVNYPMTALEISASATEEQVSEIFVRINSRGRTLNQADFILTLMSVFWDEGRKQLEEFCRRAKNPPSDNRPSPYNPYFKPQPDQLLRVDVVLAFRRARLEYVYSILRGKDLQTGEFSPERRDEQFDRLEKAQKEVLNLQNWHDFLKVIKRAGYIHHSLITSEMALVYTYSLWLIGKQDFGLDQHTLRDLMARWFFMSSLTSRYSSSAETRMEQDLTLIRGCSSSEEFVRTLEQEISAVLTNDYWNVTLPNELATASARNPGQYAFFAALCLLDAPVLYSSMKVRDLLDPTSQSHRSALERHHLFPRKYLEKLGIKDNHDINQVANFALVEWHDNVEIGDRPPSDYAPEYERRFPPDKLTEMYWYHALPEGWYNMDYWTFLEERRRRMAEIIRKGFESLK GT:EXON 1|1-584:0| BL:SWS:NREP 1 BL:SWS:REP 16->533|Y686_METJA|3e-14|28.1|462/580| SEG 161->175|rleerrglteeerqr| SEG 566->577|eerrrrmaeiir| RP:PFM:NREP 2 RP:PFM:REP 16->230|PF03235|3e-17|31.6|193/200|DUF262| RP:PFM:REP 263->554|PF09854|6e-29|36.8|261/312|DUF2081| HM:PFM:NREP 2 HM:PFM:REP 237->580|PF09854|3e-79|30.7|306/312|DUF2081| HM:PFM:REP 14->226|PF03235|1.6e-35|25.0|192/224|DUF262| OP:NHOMO 54 OP:NHOMOORG 52 OP:PATTERN ------------------------------1------1---------1-------------------- -----211111----------------------1-1--1--1------------------2---11----1----------1-------1---1----------------------------------------1---1-----------11--------------------------------1--------------1------------------11---------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------------1----1-----------------1-------------1---------------1--11-----------1------------------------------------------------------------------1----------------1----1----1----------------1-----1------------------------1--------1-------------------------------------------------1------------------------------------------------------------------1----------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 518-527| PSIPRED ccccEEccccccHHHHHHHHHcccEEcccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccEEEEEcccHHHHHHHHHHHHccHHcccccHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHEHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccEEEEccccHHHHcccccHHHHHHHccccccccHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHcc //