[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36078.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:80 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->77 1iloA PDBj 1e-17 44.6 %
:RPS:PDB   5->80 1bedA PDBj 3e-05 18.9 %
:RPS:SCOP  12->80 1wjkA  c.47.1.1 * 5e-06 13.2 %
:HMM:SCOP  2->78 1iloA_ c.47.1.1 * 2e-19 39.0 %
:HMM:PFM   10->62 PF00462 * Glutaredoxin 4.1e-06 29.8 47/60  
:HMM:PFM   56->79 PF04972 * BON 0.00099 29.2 24/64  
:BLT:SWISS 5->78 Y581_METJA 1e-17 52.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36078.1 GT:GENE AAD36078.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1017113..1017355) GB:FROM 1017113 GB:TO 1017355 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000782 percent identity: 72.37; identified by sequence similarity; putative GB:PROTEIN_ID AAD36078.1 GB:DB_XREF GI:4981540 LENGTH 80 SQ:AASEQ MAKKVEILGKGCPRCKQTEKIVRMAIEELGIDAVVEKVQDINEIVSRGVVATPAVAVDGKVVISGKIPSLDEVKKVLQQA GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 5->78|Y581_METJA|1e-17|52.1|73/86| BL:PDB:NREP 1 BL:PDB:REP 4->77|1iloA|1e-17|44.6|74/77| RP:PDB:NREP 1 RP:PDB:REP 5->80|1bedA|3e-05|18.9|74/181| HM:PFM:NREP 2 HM:PFM:REP 10->62|PF00462|4.1e-06|29.8|47/60|Glutaredoxin| HM:PFM:REP 56->79|PF04972|0.00099|29.2|24/64|BON| RP:SCP:NREP 1 RP:SCP:REP 12->80|1wjkA|5e-06|13.2|68/100|c.47.1.1| HM:SCP:REP 2->78|1iloA_|2e-19|39.0|77/77|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 163 OP:NHOMOORG 141 OP:PATTERN -----------------------1-----1----111122222-112112222--------------- --------------------------------1---------------1-----------------------------------------21-1-------------------------------11111121111111-1111---------------------1--1-----------------------1-----------------------------------------------------------------------------------------1----------------------------------------112------------1-22------------1111121-111121-11----------------------11111-------------------------------------2------1---------------------------------------------------------------------------------------1-------------1-1----11---------------1-2-11-112--21-----1-1111111111--111---1----------------1-11----1---1---1-1111-1--11111-111---1--1----------------------------------------------------------------------------------------------------------------------------------------------------1------------1------------------------------11----------------1-------------------------1111111111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 96.2 SQ:SECSTR ###EHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHHHTcccccEEEETTTEEEcGGcccHHHHHHHHHHH PSIPRED ccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHcccccccEEEEccEEEEEcccccHHHHHHHHHHc //