[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36088.1
DDBJ      :             oxidoreductase, aldo/keto reductase family
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  661/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
c.1.7
:333 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->310 1pyfA PDBj 3e-38 34.8 %
:RPS:PDB   1->318 3eauA PDBj 1e-65 29.7 %
:RPS:SCOP  6->325 1pz1A  c.1.7.1 * 2e-81 31.1 %
:HMM:SCOP  3->318 1pz1A_ c.1.7.1 * 1.2e-103 43.3 %
:RPS:PFM   17->312 PF00248 * Aldo_ket_red 3e-45 46.5 %
:HMM:PFM   18->312 PF00248 * Aldo_ket_red 4.4e-82 40.2 276/284  
:BLT:SWISS 3->294 A115_TOBAC 3e-63 45.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36088.1 GT:GENE AAD36088.1 GT:PRODUCT oxidoreductase, aldo/keto reductase family GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1023663..1024664 GB:FROM 1023663 GB:TO 1024664 GB:DIRECTION + GB:PRODUCT oxidoreductase, aldo/keto reductase family GB:NOTE similar to GB:AE000511 PID:2314358 percent identity: 71.74; identified by sequence similarity; putative GB:PROTEIN_ID AAD36088.1 GB:DB_XREF GI:4981550 LENGTH 333 SQ:AASEQ MGIPKRKLGERGPEVSAIGLGCMRMSFGQKKLPDRKEMIKLIRTAVELGINFFDTAEVYGPYTNEELVGEALEPFKGEVVIATKFGFELYEDGRPGWKGLNSNPEHIKKAVEGSLRRLRVEAIDILYQHRVDPNVPIEEVAGAVKELIEEGKVKHFGLCEASAETIRRAHKVCPVDVVQYEYSMWWRKPEEELLPTCEELGIGFVAYSPLGKGFLTGAIGENSKFDEEDSRSRIPRFQKENLRENLALVELRKTIAERKGATPSQIALAWLLAQKPWIVPIPGTTKLSHLLENIGGAFVELTPEELQEINDALSRIEIKGSRYPEDMEKMTYL GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 3->294|A115_TOBAC|3e-63|45.5|292/307| SEG 189->200|peeellptceel| BL:PDB:NREP 1 BL:PDB:REP 5->310|1pyfA|3e-38|34.8|299/309| RP:PDB:NREP 1 RP:PDB:REP 1->318|3eauA|1e-65|29.7|310/327| RP:PFM:NREP 1 RP:PFM:REP 17->312|PF00248|3e-45|46.5|271/281|Aldo_ket_red| HM:PFM:NREP 1 HM:PFM:REP 18->312|PF00248|4.4e-82|40.2|276/284|Aldo_ket_red| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00248|IPR001395| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00248|IPR001395| RP:SCP:NREP 1 RP:SCP:REP 6->325|1pz1A|2e-81|31.1|315/333|c.1.7.1| HM:SCP:REP 3->318|1pz1A_|1.2e-103|43.3|312/0|c.1.7.1|1/1|NAD(P)-linked oxidoreductase| OP:NHOMO 4355 OP:NHOMOORG 886 OP:PATTERN 331-3-23666655632944513-833A1C832----------11----1624-------16433-11 67H3S-12122-1-16511-12112C111111254535648D6KEB624DB2AEE328--9864J3EIID53333354---15--11-5732-3-----1-7133H1635--------------11-1111--12212222111B-43562332211---1--221795I5------------7631142192533333433233345332333633513414433333325L23333333333333332224137144112116633552151651212221----1111111111111-------------111---111221-122222222-213-------3-3--212-1----2-24-223121--2-57332-----B77861-346333----------5-56555B467D1-LEE9GGEPNGCE9625233721235442222222279852124-----------------------------11443424437A9AAAB8545488CB444435D8J1423--11272422434771141-2111-----------12212---2---22----3121-241157769L-21-1--------211-1--111--11132282341-6242222222122122112112--1-111------54471847778788877-667787678778A667667BCA55---435575655676566775466565--744444444444----------111-24851-15-4-------1-2223223111B255354556333454767211-12--111222222221122234658554344111--13111111111-1-----1----1-------------1------2242143444287 ------------124EBDBEDFAIKML3323334323323233222FAFNEKPKDE98888832313434589274626746663355-UlLBCaC768B554A98-16EC7776541343854662D5LX8-B8B14325347314122721735336234188113348--222547M3338DEDIOABJ64TGOI3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 332 STR:RPRED 99.7 SQ:SECSTR ccccEEEcTTcccEEEcEEEEcTTccccccccccHHHHHHHHHHHHHTTccEEEEETTGGGGHHHHHHHHHHHHHTcGcEEEEEEccccccGGGcccGGccccHHHHHHHHHHHHHHHTcccEEEEEEccccTTccHHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHHHHHHcccEEEEEccTTccHHHHHHHHHHHHHccEEEEEcTTGGGGGGTTTTTcccTTcTTcHHHHHHHHcHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHccTTccEEEEccccHHHHHHHHGGGGGGccHHHHHHHHHHHccccccccccGcccTTccc# PSIPRED ccccEEEccccccEEccEEEEcccccccccccccHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHccc //