[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36089.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->157 2ewrA PDBj 4e-85 100.0 %
:RPS:SCOP  2->157 2ewrA1  d.218.1.11 * 5e-19 98.7 %
:HMM:SCOP  1->157 2fclA1 d.218.1.11 * 1.1e-44 38.2 %
:HMM:PFM   45->99 PF09102 * Exotox-A_target 0.00099 22.6 53/143  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36089.1 GT:GENE AAD36089.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1028458..1028934 GB:FROM 1028458 GB:TO 1028934 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36089.1 GB:DB_XREF GI:4981552 LENGTH 158 SQ:AASEQ MIRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSKKVRFSSTEKICSHFGELIIDGIKVEIMGDIRKRLEDGTWEDPVDLNKYKRFVETHGMKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNERKG GT:EXON 1|1-158:0| BL:PDB:NREP 1 BL:PDB:REP 2->157|2ewrA|4e-85|100.0|154/154| HM:PFM:NREP 1 HM:PFM:REP 45->99|PF09102|0.00099|22.6|53/143|Exotox-A_target| RP:SCP:NREP 1 RP:SCP:REP 2->157|2ewrA1|5e-19|98.7|156/156|d.218.1.11| HM:SCP:REP 1->157|2fclA1|1.1e-44|38.2|157/0|d.218.1.11|1/1|Nucleotidyltransferase| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN ------------------------------------------------------11------------ ----------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 99.4 SQ:SECSTR cccHHHHHHHHHHHHHHTTccccEEEEHHHHHHHTTcccccccEEEEEcHHHHHHHHHHTGGGEEEEEEEEEcccEEEEEEEEEETTEEEEEEEEEEEccTTccccccccHHHHEEEEEETTEEEEEEcHHHHHHHHHHHTcHHHHHHHHHHHHHTc# DISOP:02AL 1-3, 155-158| PSIPRED cccHHHHHHHHHHHHHHcccccEEEEEEEHHHHccccccccccEEEEEccHHHHHHHHHHHHHccccEEEccHHHHHHcccEEEEccEEEEEcccHHHHcccccccccccccccEEEEEEccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //