[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36094.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  168/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:293 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  40->135 1s7bA  f.39.1.1 * 2e-06 12.5 %
:HMM:SCOP  38->143 1s7bA_ f.39.1.1 * 1e-08 23.8 %
:HMM:SCOP  179->286 1s7bA_ f.39.1.1 * 3.2e-11 20.2 %
:RPS:PFM   15->135 PF00892 * EamA 5e-07 33.9 %
:HMM:PFM   15->135 PF00892 * EamA 2.2e-22 31.4 121/126  
:HMM:PFM   157->279 PF00892 * EamA 8.4e-22 23.0 122/126  
:BLT:SWISS 7->266 YCXC_BACSU 8e-28 31.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36094.1 GT:GENE AAD36094.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1035101..1035982) GB:FROM 1035101 GB:TO 1035982 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:X70356 SP:Q08794 PID:396488 PID:1805427 GB:AL009126 percent identity: 57.54; identified by sequence similarity; putative GB:PROTEIN_ID AAD36094.1 GB:DB_XREF GI:4981557 LENGTH 293 SQ:AASEQ MDLRVLLSGLAYSTIFGLSFLFTKNALDYVTPLTFLSFRFIVAFLSYLLLLITGAVKLGKKPYWKLWKLVLFQPVLYFLFETYGLQRVNSSEAGMIIALIPIVVNLLAPFILKEKGDLLHYLLVGMGFLGVSLIVGFNITPGNIVGKVFMLLAVLSGAMYSVFSRKFSKEFTPTEITFFMMMTGAVFFTLLSLSTGDFRPVFNVDVVIGALYLGVLSSTVAFFLLNYAIRKLSPIFTTLFSNFTTVVSVIAGVVFRNETVGIQQIAGMGLIISSLIIMSLRRSYKRLSRAQKL GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 7->266|YCXC_BACSU|8e-28|31.9|260/312| TM:NTM 10 TM:REGION 2->24| TM:REGION 31->53| TM:REGION 64->86| TM:REGION 90->112| TM:REGION 118->140| TM:REGION 143->164| TM:REGION 174->196| TM:REGION 202->224| TM:REGION 232->254| TM:REGION 259->280| SEG 267->283|gmgliissliimslrrs| RP:PFM:NREP 1 RP:PFM:REP 15->135|PF00892|5e-07|33.9|121/125|EamA| HM:PFM:NREP 2 HM:PFM:REP 15->135|PF00892|2.2e-22|31.4|121/126|EamA| HM:PFM:REP 157->279|PF00892|8.4e-22|23.0|122/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 1 RP:SCP:REP 40->135|1s7bA|2e-06|12.5|96/106|f.39.1.1| HM:SCP:REP 38->143|1s7bA_|1e-08|23.8|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 179->286|1s7bA_|3.2e-11|20.2|104/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 317 OP:NHOMOORG 178 OP:PATTERN -------1---------------2--------------32231-----------------211----- --1-----------------------------------------------------------1---------------------1---11-1----1-----1---------------------1---------1--------1---------------------------------------1----11---1444445663545567-133145642123-1111111162-------------------1---------------------------------------------------------------111---1-22132222222-212-111---22--1---1-11-1--1-111111-1--------1---1-----------------------1------------------1-1-1-------1------------------------------------------------------------------------------------------------------------1-------1---------------13-2213214111-1-1--------------1---------------------1----111------11--------2----------------1------------------------------------------------32------------------------------------------111-11--------1----1--1-1----1322232--11--1111--11------1--1111111-1--------------1-----------------2------------------------------------------21-1121222--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 280-293| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //