[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36098.1
DDBJ      :             permease, putative
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  603/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:422 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->163 2gfpA PDBj 3e-04 14.3 %
:RPS:PDB   56->179 2d33D PDBj 3e-13 6.5 %
:RPS:SCOP  29->227 1pv6A  f.38.1.2 * 3e-15 18.0 %
:HMM:SCOP  1->397 1pw4A_ f.38.1.1 * 1.7e-67 27.0 %
:RPS:PFM   16->179 PF07690 * MFS_1 7e-19 31.1 %
:RPS:PFM   350->398 PF10136 * SpecificRecomb 8e-04 42.9 %
:HMM:PFM   7->325 PF07690 * MFS_1 2.2e-49 25.6 312/353  
:BLT:SWISS 1->409 SPNS1_XENTR 3e-19 28.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36098.1 GT:GENE AAD36098.1 GT:PRODUCT permease, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1040376..1041644) GB:FROM 1040376 GB:TO 1041644 GB:DIRECTION - GB:PRODUCT permease, putative GB:NOTE similar to GP:2695718 percent identity: 100.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36098.1 GB:DB_XREF GI:4981562 LENGTH 422 SQ:AASEQ MAVIFILILMVLLNADQMVMSPNIGAIEQEFNITDAQIGLVASSFTVIGALVSLVWGYLADRYSRKNLLIYSILVGEIPCLMSAFSRSYGELFFWRALTGIGVGASFPIVYSMIGDMFDEVKRGKVVALISSAISIGSVLGMIVGGFLGPKYGWRVPFIAVSVPNIFFAVLSIFVLKEPKRGAFEKGIGELVQSGYEYPKAPKLSDYAKLVKVKTNLLLFFQGIAGTIPWGAIPYFLVEFFRRERGLSVETATLVFLVFGLGNIVGIILGGLWGASIYAKSRPFLPLFCSITTALGTFFTVMTLDYMGSLLVLMLLGFIASFTASLTGPNVKFMLLNVNEPQERGRIFSIFNLTDSLGTGFGKFAGGVMSVALGSLGAALKVSAYFWLICAVLLFVLVFYFAKDVERLQKTMIELAKNSQTR GT:EXON 1|1-422:0| BL:SWS:NREP 1 BL:SWS:REP 1->409|SPNS1_XENTR|3e-19|28.5|403/526| TM:NTM 10 TM:REGION 3->25| TM:REGION 36->58| TM:REGION 67->89| TM:REGION 96->118| TM:REGION 126->148| TM:REGION 155->177| TM:REGION 216->238| TM:REGION 252->274| TM:REGION 293->315| TM:REGION 374->396| SEG 260->274|glgnivgiilgglwg| BL:PDB:NREP 1 BL:PDB:REP 17->163|2gfpA|3e-04|14.3|147/375| RP:PDB:NREP 1 RP:PDB:REP 56->179|2d33D|3e-13|6.5|124/499| RP:PFM:NREP 2 RP:PFM:REP 16->179|PF07690|7e-19|31.1|164/347|MFS_1| RP:PFM:REP 350->398|PF10136|8e-04|42.9|49/644|SpecificRecomb| HM:PFM:NREP 1 HM:PFM:REP 7->325|PF07690|2.2e-49|25.6|312/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 29->227|1pv6A|3e-15|18.0|194/417|f.38.1.2| HM:SCP:REP 1->397|1pw4A_|1.7e-67|27.0|382/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 3119 OP:NHOMOORG 822 OP:PATTERN --1-2-633222334331111--2------1---21-122121131-331122--2312136321--- 268-4-22665333-1--------22-----111-124A7-11-1222222-2111-1--1141215553-11112----115-1-1144-1-1------13--151428--------------1--1---211--4222211131-11-11---11------12------------------232----374999999ACC7BDABBC43DD5ACBA3458442234343F91223233321222226333442324421212663344514332343---1----1111111111111-------------------1------55---------112331111--1--2--2-FC333-1422---1------C44C-----215221-113---22232233324-11311946-44-7443651A84117343111111111--555555552--2-121----------112-22-2111-11----1-25H2-1---36BC7B77333377FD333215D2H6HB2-1655--31181313324--11-12--1-1-1---1-2512-22-1--1112232211-41112-15-111-1-1-1-1-1-1-------1----3322-2-2--43-21111-231111113214--------------54332636555655566-5656755656566666667575332647476769987757566944355651-655554455454--1-11-112333---2-----12-1111--11BB89B272316-555535943B9F737751133342212324333333131441211111111-------1331121------------------------------------11-1111111-11 1111332-2-----1-A5197CAEDID6655356544444134343776BB8886853415341--3521251-547345122-1221-975A3433237---822-3524B85A65221-14275-A5CS71769-2--6-376252--6-1512356345343A1A76E65471222Q322444489297432-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 43.4 SQ:SECSTR ################HHHHHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTGcTTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHcccc##HHHHHHHHHHHT########ccccHHHH##################################################################################################################################################################################################################### DISOP:02AL 182-200, 412-415, 417-422| PSIPRED HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //