[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36104.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   62->90 PF03867 * FTZ 0.00066 42.3 26/264  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36104.1 GT:GENE AAD36104.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1045615..1045950 GB:FROM 1045615 GB:TO 1045950 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36104.1 GB:DB_XREF GI:4981568 LENGTH 111 SQ:AASEQ MSSEFLGVQGNIARYSATYSMGTVFPQKAELIGFPSIGPFYIHPDLLKKDVVLEIPDIGFVWQNEPGSYGVDSVIYFNGQECYRASCYENGLAAEIKTVQTGLVIVQQLVE GT:EXON 1|1-111:0| HM:PFM:NREP 1 HM:PFM:REP 62->90|PF03867|0.00066|42.3|26/264|FTZ| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccccEEEEEEEEccccccccccEEEEccccccEEEcHHHHcccEEEEcccccEEEccccccccccEEEEEcccHHEEHHHcccccEEEHHHHHHHHHHHHHHHc //