[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36110.1
DDBJ      :             mannose-1-phosphate guanylyltransferase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  522/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.81.4c.68.1
:336 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->332 2cu2A PDBj 2e-36 29.9 %
:RPS:PDB   2->332 2cu2A PDBj 2e-38 31.3 %
:RPS:SCOP  3->270 2cu2A2  c.68.1.20 * 7e-45 33.5 %
:RPS:SCOP  280->332 2cu2A1  b.81.4.1 * 2e-10 28.3 %
:HMM:SCOP  2->274 1yp2A2 c.68.1.6 * 2.9e-51 33.9 %
:RPS:PFM   4->271 PF00483 * NTP_transferase 1e-18 38.4 %
:RPS:PFM   300->332 PF01050 * MannoseP_isomer 3e-04 33.3 %
:HMM:PFM   3->272 PF00483 * NTP_transferase 4e-55 38.6 233/248  
:HMM:PFM   300->332 PF01050 * MannoseP_isomer 7.5e-06 33.3 33/151  
:BLT:SWISS 1->332 ALGA_PSEPK 1e-52 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36110.1 GT:GENE AAD36110.1 GT:PRODUCT mannose-1-phosphate guanylyltransferase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1050006..1051016) GB:FROM 1050006 GB:TO 1051016 GB:DIRECTION - GB:PRODUCT mannose-1-phosphate guanylyltransferase GB:NOTE similar to GB:L11721 SP:P24174 GB:M77127 PID:147164 PID:304878 percent identity: 60.42; identified by sequence similarity; putative GB:PROTEIN_ID AAD36110.1 GB:DB_XREF GI:4981574 LENGTH 336 SQ:AASEQ MMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDVGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLFRTS GT:EXON 1|1-336:0| BL:SWS:NREP 1 BL:SWS:REP 1->332|ALGA_PSEPK|1e-52|39.4|327/485| SEG 146->161|etgygyieigeeleeg| BL:PDB:NREP 1 BL:PDB:REP 4->332|2cu2A|2e-36|29.9|321/335| RP:PDB:NREP 1 RP:PDB:REP 2->332|2cu2A|2e-38|31.3|323/335| RP:PFM:NREP 2 RP:PFM:REP 4->271|PF00483|1e-18|38.4|229/238|NTP_transferase| RP:PFM:REP 300->332|PF01050|3e-04|33.3|33/151|MannoseP_isomer| HM:PFM:NREP 2 HM:PFM:REP 3->272|PF00483|4e-55|38.6|233/248|NTP_transferase| HM:PFM:REP 300->332|PF01050|7.5e-06|33.3|33/151|MannoseP_isomer| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00483|IPR005835| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF00483|IPR005835| GO:PFM GO:0005976|"GO:polysaccharide metabolic process"|PF01050|IPR001538| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01050|IPR001538| RP:SCP:NREP 2 RP:SCP:REP 3->270|2cu2A2|7e-45|33.5|260/268|c.68.1.20| RP:SCP:REP 280->332|2cu2A1|2e-10|28.3|53/67|b.81.4.1| HM:SCP:REP 2->274|1yp2A2|2.9e-51|33.9|239/0|c.68.1.6|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 750 OP:NHOMOORG 558 OP:PATTERN -----------------------1111-1--------1-111-11-11-1111-1111111---1--- 111-1---------------------------------------11111111111111111111--------111--------1111-222313111--11111121111---------------22222222212--------11-111111--11111111111-1111111111111111-111111-1-----------1----1-------1-11----1------13------------------------------------------------------------------------------------------2--31111111111211112221-1----2-11--12-21---11-2--12111111-----211112121111222222222221-22122431121-11111121111111111211211111-1111111111111111--------------11-21---11-2-111111111----4333442233322363333234552-2111-1-221-1-1212-111122111-------11111111111221111111111211112111111121--11-------1111111111-121321-22111-111--1------1------------1111------1111-2-1222112111-2112121221212221222-2111---2122222222222222111-11111-111-111111-1----11111111111121---------------------1---11323323233211212331111111111----111111-1-1111111111111111-11111111------------------------------------1111111111121 ------------------------------------------------11---------------------------------------121-111------1----------------------------------------------------------------------1--------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 99.4 SQ:SECSTR cEEEEEEcccccGGGTTTccTTccGGGcccGGGccHHHHHHHHHHTTTccGGGEEEEEEGGGHHHHGGGcccTccEEEEEccccHHHHHHHHHHHHHHTccEEEEEEcccEEccHHHHHHHHHHHHHHccTTcEEEEEEEcccccGcccccEEEEEEEETTEEEEEEEEccccHHHHHHHHHTTEcEEEEEEEEEcHHHHHHHHHHHcHHHHHHHHHHHTTccHHTHHHHHTcccccHHHHTGGGcccEEEEEEcccEEccccTTHHHHHHTccTTccEEEEEcccccEEEEcccEEEEEccccEEEEEETTEEEEEEGGGGGGGHHHHHHHHH## DISOP:02AL 335-336| PSIPRED ccEEEEEcccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHccccEEEEEcccEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEccccccEEEEEEccccccccEEEEEEEEcccccHHHHHHHcccEEEccccEEEcHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHcccccccHHHHcccccEEEEEccEEEEEcccHHHHHHHHHHccccccEEEEcccEEEEEEccEEEEEEEcccEEEEEcccEEEEEccHHHHHHHHHHHHHHHcc //