[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36115.1
DDBJ      :             amidotransferase
Swiss-Prot:HIS5_THEMA   RecName: Full=Imidazole glycerol phosphate synthase subunit hisH;         EC=2.4.2.-;AltName: Full=IGP synthase glutamine amidotransferase subunit;AltName: Full=IGP synthase subunit hisH;AltName: Full=ImGP synthase subunit hisH;         Short=IGPS subunit hisH;AltName: Full=TmHisH;

Homologs  Archaea  55/68 : Bacteria  706/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->201 1kxjA PDBj e-117 100.0 %
:RPS:PDB   1->195 1c30B PDBj 5e-20 18.8 %
:RPS:SCOP  1->200 1gpwB  c.23.16.1 * 6e-27 100.0 %
:HMM:SCOP  1->200 1k9vF_ c.23.16.1 * 7.6e-48 34.0 %
:RPS:PFM   44->106 PF07685 * GATase_3 3e-07 33.3 %
:RPS:PFM   80->186 PF00117 * GATase 7e-08 42.4 %
:HMM:PFM   15->192 PF00117 * GATase 1.8e-24 29.7 158/192  
:BLT:SWISS 1->201 HIS5_THEMA e-117 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36115.1 GT:GENE AAD36115.1 GT:PRODUCT amidotransferase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1054239..1054844) GB:FROM 1054239 GB:TO 1054844 GB:DIRECTION - GB:PRODUCT amidotransferase GB:NOTE similar to GB:L77117 SP:Q57929 PID:1591209 percent identity: 64.25; identified by sequence similarity; putative GB:PROTEIN_ID AAD36115.1 GB:DB_XREF GI:4981579 LENGTH 201 SQ:AASEQ MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR GT:EXON 1|1-201:0| SW:ID HIS5_THEMA SW:DE RecName: Full=Imidazole glycerol phosphate synthase subunit hisH; EC=2.4.2.-;AltName: Full=IGP synthase glutamine amidotransferase subunit;AltName: Full=IGP synthase subunit hisH;AltName: Full=ImGP synthase subunit hisH; Short=IGPS subunit hisH;AltName: Full=TmHisH; SW:GN Name=hisH; OrderedLocusNames=TM_1038; SW:KW 3D-structure; Amino-acid biosynthesis; Complete proteome; Cytoplasm;Direct protein sequencing; Glutamine amidotransferase;Histidine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->201|HIS5_THEMA|e-117|100.0|201/201| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->201|1kxjA|e-117|100.0|201/203| RP:PDB:NREP 1 RP:PDB:REP 1->195|1c30B|5e-20|18.8|181/379| RP:PFM:NREP 2 RP:PFM:REP 44->106|PF07685|3e-07|33.3|63/151|GATase_3| RP:PFM:REP 80->186|PF00117|7e-08|42.4|92/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 15->192|PF00117|1.8e-24|29.7|158/192|GATase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 1->200|1gpwB|6e-27|100.0|200/200|c.23.16.1| HM:SCP:REP 1->200|1k9vF_|7.6e-48|34.0|200/200|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 936 OP:NHOMOORG 877 OP:PATTERN ---1--1111111111-1111111111111111111112111111111111111-1-111-1----11 111111111111-111111-111111111111111111111111111-1111111111--111111111111111111--11111111111111-----1-111111112---------------1111111121111111111111111111111121121-1111111112111123122111111111111111111111111111111111111111111111111111-11111111111111111-1----11-2---11--11----1-111-------111------------------------1----1----11-1111111-1-111111----1-1--1111111111-11111111--11111111-----111111211111111111111111111111111111-1111111211111111111111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111121112122111111111111111111113211111111111-111211211--1-111131111222222-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----222211211111111-1111---11111111111112111111111111-1111--------111211111111113111111111111111121112211--------------------------------------1--1-111111 ------1-----11111111111121111111111111-1111111111111111111111111111111111111111111111111-12111111-11-21111-11--------------------------------------------------------1-------1-1-118111111112-11111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHccHHHHTTcccEEEEcccccccTTcHHHHHHHHHHHTccccEEEETHHHHHHHHHTTcHTTccEEEEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEccTTEEccTTEEEEEEETTTccEEEEEEccccEEEEcccTTcccccTTHHHHHHHHHHHHHH DISOP:02AL 201-202| PSIPRED cEEEEEEccccHHHHHHHHHHHHcccccEEEEEEcccHHHHcccEEEEcccccHHHHHHHHHHcccHHHHHHHHHccccEEEEEHHHHHHHHccccccccccccccccEEEEcccccccccccccEEEEccccccEEEEEEEEEEEcccccEEEEEEEccEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHcc //