[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36121.1
DDBJ      :             transposase, IS605-TnpB family
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  218/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
g.41.5g.72.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   100->209 3ee7B PDBj 2e-17 6.6 %
:RPS:PDB   332->363 3a43B PDBj 4e-04 35.7 %
:RPS:SCOP  309->362 1wj0A  g.72.1.1 * 3e-18 15.1 %
:HMM:SCOP  323->379 1dx8A_ g.41.5.1 * 0.00038 24.6 %
:RPS:PFM   4->37 PF12323 * HTH_14 6e-08 61.8 %
:RPS:PFM   74->289 PF01385 * Transposase_2 3e-37 50.7 %
:RPS:PFM   304->371 PF07282 * Transposase_35 2e-13 54.5 %
:HMM:PFM   71->287 PF01385 * Transposase_2 1.9e-42 30.0 210/227  
:HMM:PFM   301->371 PF07282 * Transposase_35 3.5e-29 54.4 68/69  
:HMM:PFM   4->44 PF12323 * HTH_14 5.9e-20 61.0 41/46  
:BLT:SWISS 1->363 YSNA_STRPR 5e-46 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36121.1 GT:GENE AAD36121.1 GT:PRODUCT transposase, IS605-TnpB family GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1059181..1060398) GB:FROM 1059181 GB:TO 1060398 GB:DIRECTION - GB:PRODUCT transposase, IS605-TnpB family GB:NOTE similar to GB:AE000511 PID:2313541 PID:2314128 PID:2314141 PID:2314245 percent identity: 62.77; identified by sequence similarity; putative GB:PROTEIN_ID AAD36121.1 GB:DB_XREF GI:4981585 LENGTH 405 SQ:AASEQ MTKMLRTYKFRIYPTREQEEKLAKHFGHTRFVYNFFLNYANIIYRVMERPTYYNEWASVLVKLKKTNKYSWLNEVNSQALQQSLKDLERAFKNFFKKQAGYPKFKKKKFSRQTFRIPQHIQLYIKEDNPKYGCIFVPKFKEGIKVRLHRKLPKDGKIKQATFIKTATNKYYAAIVFEVQDAEVQNTSTGILGIDLGIKDTITLSDGKKYKMPDLSKYERQIKRLHRRLSRKQRGSKNWEKARLCLAKLYEKIVNIKNDWLHKITHDLVSESQAGKIVVEDLNIKGMVQNHRLARHIHMQSWRRFLELLEYKAKRCGIEVIKANRYYPSSQMCSECGYINKEVKDLSVREWTCPVCGAHHDRDVNAAKNLVRYGLMLSIGREPSEFTPVDSALAAEPERGLRAITG GT:EXON 1|1-405:0| BL:SWS:NREP 1 BL:SWS:REP 1->363|YSNA_STRPR|5e-46|31.8|352/402| RP:PDB:NREP 2 RP:PDB:REP 100->209|3ee7B|2e-17|6.6|106/115| RP:PDB:REP 332->363|3a43B|4e-04|35.7|28/117| RP:PFM:NREP 3 RP:PFM:REP 4->37|PF12323|6e-08|61.8|34/46|HTH_14| RP:PFM:REP 74->289|PF01385|3e-37|50.7|203/207|Transposase_2| RP:PFM:REP 304->371|PF07282|2e-13|54.5|66/70|Transposase_35| HM:PFM:NREP 3 HM:PFM:REP 71->287|PF01385|1.9e-42|30.0|210/227|Transposase_2| HM:PFM:REP 301->371|PF07282|3.5e-29|54.4|68/69|Transposase_35| HM:PFM:REP 4->44|PF12323|5.9e-20|61.0|41/46|HTH_14| RP:SCP:NREP 1 RP:SCP:REP 309->362|1wj0A|3e-18|15.1|53/58|g.72.1.1| HM:SCP:REP 323->379|1dx8A_|0.00038|24.6|57/0|g.41.5.1|1/1|Rubredoxin-like| OP:NHOMO 1193 OP:NHOMOORG 250 OP:PATTERN ------1-711513N4-2------3342567K-1---2----------235F4--1--1-1-221--- ----1------------22-22----22222-2---2-76-18J------------------1---D3213----61----------4--------------------7---------------------------C-12----4-24Z4QK*Lm11------21a3AM27-------------28-----1D-3333357C36432481-----2345211-D3------4----------------1----16-2--19-H2--5523-2---------------------------------------------------53---------3-5--933-73N34--5--11211A----2--22-3--7-----------------------------------------3-2--------------------------------111111112-----------------------------------------------B77-3B-------1-------1----1------------C1----------------------2----1--------------------------------------3-2-61----------2-----2----31--------3------------2J-------------3--12221-1-33-22132113132-3111111-------D---1---1--11211221111233------------------------------1-------------74---------1J5----------------------------------------------------1-32----------2115--1-----------------------------1-54-82626E-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---- STR:NPRED 134 STR:RPRED 33.1 SQ:SECSTR ###################################################################################################ccEEEEEEEEccTTTcccE##EEEEEEEccccccEEEEEEEccccccEEEEEc#TTcccEEEEEccccEEEEEccTTccEEEEEEEcTT#ccHHHHHHHHHHHHcccccc##########################################################################################################################ETTTccE####EccccccccccccccccEEEc########################################## DISOP:02AL 1-2, 229-240, 380-405| PSIPRED cccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEcccEEEEEcccEEEEEEEEEEEccEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEcccccccccccEEEEEccccEEEEEEccEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccccEEEEccccEEEEcHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHccccc //