[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36127.1
DDBJ      :             endoglucanase
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  276/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.49.3c.56.5
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->331 3isxA PDBj e-162 100.0 %
:RPS:PDB   3->329 2cf4A PDBj 4e-25 30.1 %
:RPS:SCOP  3->65 1yloA2  c.56.5.4 * 6e-17 37.5 %
:RPS:SCOP  65->168 2greA1  b.49.3.1 * 6e-15 20.7 %
:RPS:SCOP  150->329 1yloA2  c.56.5.4 * 2e-53 25.6 %
:HMM:SCOP  1->329 1yloA2 c.56.5.4 * 3.3e-55 35.9 %
:RPS:PFM   42->324 PF05343 * Peptidase_M42 8e-51 42.9 %
:HMM:PFM   42->324 PF05343 * Peptidase_M42 2.5e-90 45.0 282/292  
:BLT:SWISS 1->326 GUNM_CLOTM 2e-63 42.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36127.1 GT:GENE AAD36127.1 GT:PRODUCT endoglucanase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1065641..1066636 GB:FROM 1065641 GB:TO 1066636 GB:DIRECTION + GB:PRODUCT endoglucanase GB:NOTE similar to SP:P55742 percent identity: 64.71; identified by sequence similarity; putative GB:PROTEIN_ID AAD36127.1 GB:DB_XREF GI:4981592 LENGTH 331 SQ:AASEQ MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 1->326|GUNM_CLOTM|2e-63|42.8|318/330| SEG 100->114|gtigvvgmegettee| BL:PDB:NREP 1 BL:PDB:REP 2->331|3isxA|e-162|100.0|322/326| RP:PDB:NREP 1 RP:PDB:REP 3->329|2cf4A|4e-25|30.1|316/327| RP:PFM:NREP 1 RP:PFM:REP 42->324|PF05343|8e-51|42.9|282/292|Peptidase_M42| HM:PFM:NREP 1 HM:PFM:REP 42->324|PF05343|2.5e-90|45.0|282/292|Peptidase_M42| RP:SCP:NREP 3 RP:SCP:REP 3->65|1yloA2|6e-17|37.5|63/264|c.56.5.4| RP:SCP:REP 65->168|2greA1|6e-15|20.7|92/94|b.49.3.1| RP:SCP:REP 150->329|1yloA2|2e-53|25.6|180/264|c.56.5.4| HM:SCP:REP 1->329|1yloA2|3.3e-55|35.9|245/0|c.56.5.4|1/1|Zn-dependent exopeptidases| OP:NHOMO 536 OP:NHOMOORG 326 OP:PATTERN 111-11----------222222211--1112111111111111111111111113332233---3--- --1----------------------1-----------------------------------------------------11-2--------1----21-1-111112111--------------------------22211---14-------------------------------------411--4414222222222222222223222222222222423222222312222222222222222222231-1-21-111----11---11-11111111111111111111111111111111111111111111111-3331111-111-1-31333-----3--4----33-----1--363----1-1----------------------------------1--1--------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------111111111-------1-----------------------------------------------------------------------------3221311122-2232221222222333332--------1111111111111111-2-12222-----------------------1111-------------------------------------1----1-----------------------------------------------1----------------21-1---2--12--111----121114433334333113 -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 331 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHccccTTccHHHHHHHHHTTTTcccGcEEcccccEEEcccEccccccEEEEccccEEEEEEEcTTccEEEEEEccccGGGTTTcEEEccccEEEEEccccccccccccccccccTTccccccccccHHHHHTTccTTcEEEEccccEEccccEEEcTTHHHHHHHHHHHHHHHcccccccEEEEEcccTTTcHHHHHHTTTcccccEEEccEEEccccccTTccTTcccEEEEEcEEEcccccccHHHHHHHHHHHHTTTcccEEEEccccccGGGGTTTccccccEEEEEEEEEcTTTTTcEEEHHHHHHHHTTccTTTHH DISOP:02AL 111-121| PSIPRED cHHHHHHHHHcccccccHHHHHHHHHHHHHHHccEEEEccccEEEEEEcccccEEEEEEEccEEEEEEEEEccccEEEEEEcccccHHHEEccEEEEEcccEEEEccccccccccccccccccHHHEEEEEccccHHHHHHccccccEEEEcccEEEEccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccEEEEEEEEEEcccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHccccccEEEEEcccccccccEEEEcHHHHHHHHHHHHHHHcc //