[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36133.1
DDBJ      :             periplasmic divalent cation tolerance protein
Swiss-Prot:CUTA_THEMA   RecName: Full=Divalent-cation tolerance protein cutA;

Homologs  Archaea  33/68 : Bacteria  107/915 : Eukaryota  52/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 1o5jA PDBj 4e-45 100.0 %
:RPS:PDB   1->100 2e66A PDBj 3e-16 43.0 %
:RPS:SCOP  2->100 1j2vA  d.58.5.2 * 2e-26 41.4 %
:HMM:SCOP  1->102 1ukuA_ d.58.5.2 * 4.6e-33 41.2 %
:RPS:PFM   1->99 PF03091 * CutA1 7e-14 39.4 %
:HMM:PFM   1->100 PF03091 * CutA1 1.5e-40 50.0 100/102  
:BLT:SWISS 1->101 CUTA_THEMA 4e-47 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36133.1 GT:GENE AAD36133.1 GT:PRODUCT periplasmic divalent cation tolerance protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1069580..1069885) GB:FROM 1069580 GB:TO 1069885 GB:DIRECTION - GB:PRODUCT periplasmic divalent cation tolerance protein GB:NOTE similar to GB:AE000782 percent identity: 66.33; identified by sequence similarity; putative GB:PROTEIN_ID AAD36133.1 GB:DB_XREF GI:4981598 LENGTH 101 SQ:AASEQ MILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESVL GT:EXON 1|1-101:0| SW:ID CUTA_THEMA SW:DE RecName: Full=Divalent-cation tolerance protein cutA; SW:GN Name=cutA; OrderedLocusNames=TM_1056; SW:KW 3D-structure; Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|CUTA_THEMA|4e-47|100.0|101/101| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 59->72|eekekelyeelrkl| BL:PDB:NREP 1 BL:PDB:REP 2->101|1o5jA|4e-45|100.0|99/102| RP:PDB:NREP 1 RP:PDB:REP 1->100|2e66A|3e-16|43.0|100/102| RP:PFM:NREP 1 RP:PFM:REP 1->99|PF03091|7e-14|39.4|99/101|CutA1| HM:PFM:NREP 1 HM:PFM:REP 1->100|PF03091|1.5e-40|50.0|100/102|CutA1| GO:PFM:NREP 1 GO:PFM GO:0010038|"GO:response to metal ion"|PF03091|IPR004323| RP:SCP:NREP 1 RP:SCP:REP 2->100|1j2vA|2e-26|41.4|99/102|d.58.5.2| HM:SCP:REP 1->102|1ukuA_|4.6e-33|41.2|102/0|d.58.5.2|1/1|GlnB-like| OP:NHOMO 227 OP:NHOMOORG 192 OP:PATTERN ---1-111----------111111----------11--1111111---1--1-11111111--11-11 -11--------------------------------------111---------------------1-----------------111-1-------------------------------------11-1----------11------1---------------1-----------------1-111--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1------------------1-1--------------11111111--1-------------1--------------------------11-111111111--11-------------11-------------------------------------1111-----------------1--11----------11--1-11----11-11--1------------------------------------------1---------1-1-11111--1------1--1------11-----------1------------------------------1----1--1---------------------------11111111111---------------------------------------------------------------------------------------1--------------1---1111-----------------------------------------11111--- 1-11--1---1-----------------------------------------------------------------------------------------------1---121-21-11---1132-21B45-213--1-11131-11--31-31---1---11---1-3--11-11--------1121-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEccHHHHHHHHHHHHHTTcccEEEEEEEEEEEEETTEEEEEEEEEEEEEEcGGGHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHTcc DISOP:02AL 101-102| PSIPRED cEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEccEEEEcccEEEEEEEcHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHcc //