[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36136.1
DDBJ      :             spoVS-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->83 2ek0A PDBj 2e-27 66.3 %
:RPS:PDB   1->86 2ek0A PDBj 7e-34 64.0 %
:RPS:PFM   2->83 PF04232 * SpoVS 3e-26 82.9 %
:HMM:PFM   1->85 PF04232 * SpoVS 2.4e-48 78.8 85/86  
:BLT:SWISS 1->86 SP5S_BACSU 7e-26 59.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36136.1 GT:GENE AAD36136.1 GT:PRODUCT spoVS-related protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1072647..1072910) GB:FROM 1072647 GB:TO 1072910 GB:DIRECTION - GB:PRODUCT spoVS-related protein GB:NOTE similar to SP:P45693 PID:862985 GB:AL009126 percent identity: 48.70; identified by sequence similarity; putative GB:PROTEIN_ID AAD36136.1 GB:DB_XREF GI:4981602 LENGTH 87 SQ:AASEQ MEVLKVSSKSDPNKVAGAIAGVVREHGKAEIQAIGAGAVNQAVKAIAIARGYLAPSGIDLVFVPAFTDVEIENEKRTAIKFIVFPKS GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 1->86|SP5S_BACSU|7e-26|59.3|86/100| BL:PDB:NREP 1 BL:PDB:REP 1->83|2ek0A|2e-27|66.3|83/90| RP:PDB:NREP 1 RP:PDB:REP 1->86|2ek0A|7e-34|64.0|86/90| RP:PFM:NREP 1 RP:PFM:REP 2->83|PF04232|3e-26|82.9|82/86|SpoVS| HM:PFM:NREP 1 HM:PFM:REP 1->85|PF04232|2.4e-48|78.8|85/86|SpoVS| OP:NHOMO 153 OP:NHOMOORG 108 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111------------------------------------------------------11111---11-------------------------------------1111111-1112222222212222221111112221111111------11------------------------------------------------------------------------------------------21121111111111111111111--2--2--21111111231222321---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2222232333--- ------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1-------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 98.9 SQ:SECSTR ccEEEEcTTccHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEEEETTEEEEEEEEEEEEE# DISOP:02AL 6-7| PSIPRED ccEEEEEccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHEEEEEEcccccEEEEcccEEEEEEcccEEEEEEEEEEEcc //