[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36147.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.123.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->114 1nc7D PDBj 6e-56 100.0 %
:RPS:SCOP  2->114 1nc7A  b.123.1.1 * 8e-24 95.6 %
:HMM:SCOP  1->115 1nc7A_ b.123.1.1 * 6.2e-51 54.8 %
:RPS:PFM   3->111 PF07100 * ASRT 6e-27 54.1 %
:HMM:PFM   2->113 PF07100 * ASRT 7.6e-44 51.8 112/121  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36147.1 GT:GENE AAD36147.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1085964..1086308 GB:FROM 1085964 GB:TO 1086308 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36147.1 GB:DB_XREF GI:4981614 LENGTH 114 SQ:AASEQ MNGARKWFFPDGYIPNGKRGYLVSHESLCIMNTGDETAKIRITFLFEDSKPVVHEVEISPMKSLHLRLDKLGIPKCKPYSIMAESNVPVVMQLSRLDVGKNHYTLMTTIGYWEE GT:EXON 1|1-114:0| BL:PDB:NREP 1 BL:PDB:REP 2->114|1nc7D|6e-56|100.0|108/111| RP:PFM:NREP 1 RP:PFM:REP 3->111|PF07100|6e-27|54.1|109/121|ASRT| HM:PFM:NREP 1 HM:PFM:REP 2->113|PF07100|7.6e-44|51.8|112/121|ASRT| RP:SCP:NREP 1 RP:SCP:REP 2->114|1nc7A|8e-24|95.6|113/116|b.123.1.1| HM:SCP:REP 1->115|1nc7A_|6.2e-51|54.8|115/116|b.123.1.1|1/1|Hypothetical protein TM1070| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------2------------------------------------------------------------------------------------11-------------------11-1-------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1-----------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------11-------------------------11-1----------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 99.1 SQ:SECSTR #ccEEEEEEEEEcccccEETTEEcEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEcTTEEEEEEGGGccccTTccEEEEEEEEEEEEEEEEEEEEETTEEEEHEEEcEEEc DISOP:02AL 1-3| PSIPRED ccccEEEEEcccccccccccccEEcEEEEEEEccccccEEEEEEEEcccccccEEEEEcccEEEEEEEccccccccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHcc //