[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36167.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36167.1 GT:GENE AAD36167.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1107675..1108196 GB:FROM 1107675 GB:TO 1108196 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36167.1 GB:DB_XREF GI:4981635 LENGTH 173 SQ:AASEQ MKILVGSPVSLEEFETIDLFISWLDVIPDNARFSIVGTSKFFIIGKNGREWKKGYEFGIVDADINIFVVGGDLALYPEVFYIAKENGAKLVVGFCEIQNFIDFNFVKAKFWAHTQETSLASIVLLNFLGKVHNNIYFPLEKTKNQTGVVAEGVAPVFLELKKNFFSSEEAEDV GT:EXON 1|1-173:0| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 3-4, 167-173| PSIPRED cEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEccccHHHcccEEEEEEccEEEEEEcccEEEccEEEEEEcccccEEEEEEEHHccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHccEEEEEEcccccccEEEcccHHHHHHHHHHHccccccccc //