[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36190.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:PROS 181->189|PS00923|ASP_GLU_RACEMASE_1
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36190.1 GT:GENE AAD36190.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1126228..1126905 GB:FROM 1126228 GB:TO 1126905 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36190.1 GB:DB_XREF GI:4981660 LENGTH 225 SQ:AASEQ MRKLLWLVLMGALFTFALAQSALEVWKYENGQYISLPATNDLARAFSAFPADGSCNKPEWQIEFTTEVQVAQWLEWSLSATKWTWFVRKPGDYYANSVTGTIASNGDVIVSFSGFDDPTYTGTSSVNPEIEAYYTVMTTEGMPDQNSWVRAPDVNNLSYTLVDSEALHNGMLFYLWNRIKVVNCNSASTYRNTGYIYLTLQNQKPWIDEEGNYVEDLENYVTSER GT:EXON 1|1-225:0| PROS 181->189|PS00923|ASP_GLU_RACEMASE_1|PDOC00714| TM:NTM 1 TM:REGION 4->26| OP:NHOMO 10 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 222-225| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccHHHHEEEcccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEcccEEEEEEccccccccccccccccEEEEEEEEccEEcccccccccccccccEEEEEEEcHHHHHcccEEEEEEEEEEccccccccEEccEEEEEEEEcccccccccccHHHHHHHHHcccc //