[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36191.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 47->167 DTML_BURP6 4e-04 30.4 %
:PROS 172->180|PS00923|ASP_GLU_RACEMASE_1
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36191.1 GT:GENE AAD36191.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1126967..1127617 GB:FROM 1126967 GB:TO 1127617 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36191.1 GB:DB_XREF GI:4981661 LENGTH 216 SQ:AASEQ MRRLLLIMLALVVSSMFFAGFVDVYAYEGDPDNAKAFVSMGDSGHCNRHVWEIPMTLEVQVAQWVHWNLTGTKWTWFVRKPGTYVANCITATLQSNSDLEITFSGFDHLKYATGTSVNDTIEVEYAFGQQVYSIPEDNWTPAPDLNSVELLVPDSRVLHNGATYKLWNRIHVVRCNSASTYRDSGIIMLTLKNQKPWIDDEGNYADDLEKYVNNQR GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 47->167|DTML_BURP6|4e-04|30.4|112/687| PROS 172->180|PS00923|ASP_GLU_RACEMASE_1|PDOC00714| TM:NTM 1 TM:REGION 4->25| OP:NHOMO 14 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32333--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 213-216| PSIPRED cHHHHHHHHHHHHHHHHHHHEEEEEEEcccccHHHHEEEcccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEcccEEEEEEccccccccccccccccEEEEEEEEccEEcccccccccccccccEEEEEEcccHHHccccEEEEEHEEEcccccccccEEccEEEEEEEEcccccccccccHHHHHHHHHcccc //