[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36201.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->55 PF11915 * DUF3433 0.00073 26.0 50/699  
:BLT:SWISS 42->122 DPO1_BORBU 8e-04 25.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36201.1 GT:GENE AAD36201.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1138276..1138680) GB:FROM 1138276 GB:TO 1138680 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36201.1 GB:DB_XREF GI:4981671 LENGTH 134 SQ:AASEQ MRNGSLIVETLISLFLILLTVVIFTTIIVGVAKNVTFTEESIETFLFTNFAYDFLSKYEVGHEIEQGVYEEINREFWKDKWNDQNPPFPHIDPSVSTVEDVALPSSSDVKYKKITLKIKINEGASIERIVIIGD GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 42->122|DPO1_BORBU|8e-04|25.3|79/100| TM:NTM 1 TM:REGION 9->31| SEG 8->31|vetlislflilltvvifttiivgv| HM:PFM:NREP 1 HM:PFM:REP 2->55|PF11915|0.00073|26.0|50/699|DUF3433| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccEEEEEEEEEEEcccccEEEEEEEEc //