[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36209.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:412 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  224->349 1j6pA2  c.1.9.9 * 2e-04 23.9 %
:RPS:PFM   192->238 PF01882 * DUF58 4e-05 44.7 %
:HMM:PFM   189->276 PF01882 * DUF58 9.2e-18 32.9 82/86  
:BLT:SWISS 40->195 TRMD_DICTD 5e-04 26.1 %
:BLT:SWISS 203->275 NUSB_FERNB 9e-04 26.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36209.1 GT:GENE AAD36209.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1145502..1146740 GB:FROM 1145502 GB:TO 1146740 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 46.32; identified by sequence similarity; putative GB:PROTEIN_ID AAD36209.1 GB:DB_XREF GI:4981680 LENGTH 412 SQ:AASEQ MRVRKKPLVILTIFSVAVWILTQNNIFLLMVFFTATRWLDLLLTLKAIPKIKIERHITKTRLFVDEKAEMIYKIRYSGHLRISMKLNPSFSPVRFFKKDTEEVSLTPSSSEKLVFIFSFGTRGRKILKGFSIKIEDTFATFSVEKEFNAEDEVIVFPEYVPIEFYKEALKELLPGRKSPQRLLEDNTMLKGLRDYNGEPMNRIHWKASARYGRLLVKEHDHTALGRVKIFLDLNLPRDVQLGEVWKELRRYYEEEAVRFVASVVKDLKERHTPVELTVIGEEIWKNHDRDWVMDFELLATVRGTDNSRFDTKSVLETVVFDPSDTVLLFCVHLTEQELPLLLRVRSQVSKLIVFVIPYGLRDPNTKPFRSYLLMRKDLLDLLEKVKLLEENHVIVRGVRENMTVQEVVESVP GT:EXON 1|1-412:0| BL:SWS:NREP 2 BL:SWS:REP 40->195|TRMD_DICTD|5e-04|26.1|153/245| BL:SWS:REP 203->275|NUSB_FERNB|9e-04|26.1|69/100| TM:NTM 1 TM:REGION 9->31| SEG 372->390|llmrkdlldllekvkllee| RP:PFM:NREP 1 RP:PFM:REP 192->238|PF01882|4e-05|44.7|47/86|DUF58| HM:PFM:NREP 1 HM:PFM:REP 189->276|PF01882|9.2e-18|32.9|82/86|DUF58| RP:SCP:NREP 1 RP:SCP:REP 224->349|1j6pA2|2e-04|23.9|109/281|c.1.9.9| OP:NHOMO 44 OP:NHOMOORG 43 OP:PATTERN ----------------------------------------11-------------------------- ------------------------------------------11---------------------------------------1----------------------------------------------------1--11---1--------------------------------------------1----11111-11-111111------111-11---------------------------------------------------------------------------------------------------------------------1--------1--------------1---111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 164-188| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccEEccccEEEEEEEEEEccEEEEEEEEcccccccccccccccEEEEcccccEEEEEEEEccccEEEEcccEEEEEEccEEEEEEEEEEccccEEEEEccccccccccHHHHccccccccccccccccccHHHHcccccccccccHHHHHHccccEEEEEEccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHccEEcccccccccccEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHccc //