[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36216.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  533/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.37.1d.58.18
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->129 2rc3B PDBj 4e-14 40.4 %
:RPS:PDB   1->132 2d4zA PDBj 5e-23 14.5 %
:RPS:PDB   113->206 3dc2A PDBj 1e-06 14.9 %
:RPS:SCOP  3->134 3ddjA2  d.37.1.1 * 2e-32 28.9 %
:RPS:SCOP  131->211 1psdA3  d.58.18.1 * 5e-06 21.2 %
:HMM:SCOP  1->55 2d4zA2 d.37.1.1 * 9.9e-14 43.6 %
:HMM:SCOP  65->142 2d4zA2 d.37.1.1 * 1.4e-19 41.0 %
:HMM:SCOP  142->211 1y7pA2 d.58.18.12 * 3.8e-07 28.6 %
:RPS:PFM   10->175 PF00478 * IMPDH 3e-15 37.7 %
:HMM:PFM   3->55 PF00571 * CBS 4.4e-18 39.6 53/57  
:HMM:PFM   77->131 PF00571 * CBS 4.1e-25 47.3 55/57  
:HMM:PFM   147->174 PF01842 * ACT 4.7e-07 42.9 28/66  
:BLT:SWISS 6->160 IMDH_PYRAB 4e-20 46.0 %
:BLT:SWISS 151->206 SPOT_AQUAE 2e-04 37.5 %
:REPEAT 2|1->53|75->128

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36216.1 GT:GENE AAD36216.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1152812..1153459 GB:FROM 1152812 GB:TO 1153459 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000666 percent identity: 62.41; identified by sequence similarity; putative GB:PROTEIN_ID AAD36216.1 GB:DB_XREF GI:4981687 LENGTH 215 SQ:AASEQ MLVKDFMTRNPITIAPETSFSEALKLMKQNKIKRLIVMKNEKIVGIVTEKDLLYASPSKATTLNIWELHYLLSKLKIEEIMTKDVVTVNENTPIEDAARIMEEKDISGLPVVDDAGRLVGIITQTDIFKVFVEIFGTKREGTIRYTMEMPDKPGELLEVAKRIYEAGGNIISIATLFEEGKDSYLATLRVENIDHEKFVKSLDEIDVKLLYYHSN GT:EXON 1|1-215:0| BL:SWS:NREP 2 BL:SWS:REP 6->160|IMDH_PYRAB|4e-20|46.0|126/485| BL:SWS:REP 151->206|SPOT_AQUAE|2e-04|37.5|56/696| NREPEAT 1 REPEAT 2|1->53|75->128| BL:PDB:NREP 1 BL:PDB:REP 12->129|2rc3B|4e-14|40.4|104/127| RP:PDB:NREP 2 RP:PDB:REP 1->132|2d4zA|5e-23|14.5|131/169| RP:PDB:REP 113->206|3dc2A|1e-06|14.9|94/526| RP:PFM:NREP 1 RP:PFM:REP 10->175|PF00478|3e-15|37.7|146/459|IMPDH| HM:PFM:NREP 3 HM:PFM:REP 3->55|PF00571|4.4e-18|39.6|53/57|CBS| HM:PFM:REP 77->131|PF00571|4.1e-25|47.3|55/57|CBS| HM:PFM:REP 147->174|PF01842|4.7e-07|42.9|28/66|ACT| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 2 RP:SCP:REP 3->134|3ddjA2|2e-32|28.9|128/132|d.37.1.1| RP:SCP:REP 131->211|1psdA3|5e-06|21.2|80/84|d.58.18.1| HM:SCP:REP 1->55|2d4zA2|9.9e-14|43.6|55/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 65->142|2d4zA2|1.4e-19|41.0|78/0|d.37.1.1|2/2|CBS-domain| HM:SCP:REP 142->211|1y7pA2|3.8e-07|28.6|70/0|d.58.18.12|1/1|ACT-like| OP:NHOMO 1356 OP:NHOMOORG 617 OP:PATTERN 5414268457675658-1323644311321-276DBA88A99A884A789978765543433325-28 112----1111---------------------------11--1---1-1--1-----1--11---2--1--1111111----322323111112-----121-1421141------------------11------66655---1433321122111------232-21421---11111--112133331143111113333231333333324222444213111111122311111111111111-11-12---11-----1---11-1----1112222111222222222222221111111111111222221222212342222222212212224333231--2--44445454444421111--11-111-11111126224221121111111111111-12111321422122233134112311--12-1121111111111111112--221111----------------------1111-2111------5111232111111161111-11212211132221-22212222-122-3-111111111133242117533543386444112112111-44342-181111-221111---------1--11--11-1-1--111-2222-21222212-1222----52-----------------------------------------------------------------------------------------------1--1-1-11-1-3-----1-1--1111-1111112---2-21221---111111------------11112-----11111---1-11-------1-1---2211----------------------------1-------22-3435333-1- ----12----------1-------------------------------------------------1-------------------------1----------------1-----------------------------------------------------------1------11--1--111234-21-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 95.8 SQ:SECSTR ccTTcccccccccEETTccHHHHHHHHHHccccEEEEETTccEEEEEEHHHHHHHcccHHHHHHHHHHHTTccccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEETTTEEEEEEEHHHHHHHHHHHHTEEEcccEEEEcTTcccHHHHHHHHHHHHHHHccEEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHH######### DISOP:02AL 215-216| PSIPRED ccHHHccccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHcccccccHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHccccEEEEEEEccccccEEEEEEEEEccccHHHHHHHHHcccEEEEEEcc //