[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36221.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  350/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.211.1d.133.1
:379 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   155->338 3ccgA PDBj 8e-24 16.9 %
:RPS:SCOP  126->315 1dgjA4  d.133.1.1 * 4e-29 10.6 %
:HMM:SCOP  142->337 1xx7A_ a.211.1.1 * 6.7e-40 37.5 %
:RPS:PFM   172->294 PF01966 * HD 4e-08 39.6 %
:HMM:PFM   172->296 PF01966 * HD 9.3e-26 38.3 115/118  
:BLT:SWISS 162->335 Y2027_AQUAE 3e-28 41.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36221.1 GT:GENE AAD36221.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1156870..1158009) GB:FROM 1156870 GB:TO 1158009 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to PID:558266 percent identity: 56.47; identified by sequence similarity; putative GB:PROTEIN_ID AAD36221.1 GB:DB_XREF GI:4981692 LENGTH 379 SQ:AASEQ MEAIQVASVKDNFVKTLEKIRKKHGVDIIALFAIRQSLAIHVINSADNPVSFSAGTIFNLTLTPLVEEFLFNVKTFENHPQKTRFALVENVQWELYIPVVFKEFPTGFVYVASKKKRDAEKTEGIIRDLQDFLKAHGLEYYFLEYSVVLDQLLTTVAILIDRLFSRVSRYTLNHIYNVAFWAEEIGKIVGLDEKRLAKLYLAGLLHDIGKVYIDERILNKEGRLTLQEYQEMKKHVDYSYNMVKDLMIWDIEDDVALWVVQHHEKFDGSGYPFGLKEEEITPEGRILKIADTLDAMLSPRSYRNPFPLDDVIKEIERLRGKDFDPLLADLTVDLLREKKESLGLFEGRILPATLIAGEGIHEGILRKNDGYHVFISDYV GT:EXON 1|1-379:0| BL:SWS:NREP 1 BL:SWS:REP 162->335|Y2027_AQUAE|3e-28|41.5|171/364| RP:PDB:NREP 1 RP:PDB:REP 155->338|3ccgA|8e-24|16.9|178/184| RP:PFM:NREP 1 RP:PFM:REP 172->294|PF01966|4e-08|39.6|111/117|HD| HM:PFM:NREP 1 HM:PFM:REP 172->296|PF01966|9.3e-26|38.3|115/118|HD| RP:SCP:NREP 1 RP:SCP:REP 126->315|1dgjA4|4e-29|10.6|180/596|d.133.1.1| HM:SCP:REP 142->337|1xx7A_|6.7e-40|37.5|168/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 1549 OP:NHOMOORG 352 OP:PATTERN -------------------------------------------------------------------- 291-2---------------------------1-1---111---1-----------------1---111-1---------2-21-2---------------------------------------------11-4-5445532342-11-11-2311-------21-1111------------9435289156-11111--1-111--1-2----11-1323223------86------------------------------------------------------------------------------------------5D39D45455764765-663122718--455BEEE7DCF4EDA87573--656-----------3231111-112------------76569346-1---11211-331--1-------------------------1-D21--------------------------------1--1111-------11111--2-1111-1-1-1311-2332823126--8--3262272A3--------1146J2AA8A6DC5GGCCC1DGEBCAE59334341766-------------------222----C81765214348B899873999588356FB---1145-----------1-------------------------------11-----------------------------------------------4---------118-4-------------------------231111-1-13----2111---------2322277777348BB22333333331111--D23322111--1-111431-------------------------8D1BC7AA99--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 69.4 SQ:SECSTR ####################################################################################################################cGGGcccccccccccccccHHHHTTHHHHHHHHcHHHHcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHTTTTTTccHHHHHHHHHHTTccccHHHHTTTTcHcHHHHHHHHccccHHHHHHHHTTTTcccccHHHHHHHHHHHHcTTcccTTHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHTccccHHHHHHHHHHHHHcHHHHHHTTccccGGGcTTTccHHHHHHHHHHHTHHHHHHHH DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccEEccccEEEcccHHHHHHHHHHHHHHHHcccccHHHHEEcccccEEEEEEEccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEHHHHccccccEEEEcccc //