[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36241.1
DDBJ      :             2-oxoacid ferredoxin oxidoreductase, beta subunit
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  254/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->122 2pgnA PDBj 4e-05 26.7 %
:RPS:PDB   13->211 3ea4A PDBj 2e-21 13.7 %
:RPS:SCOP  51->264 1b0pA2  c.36.1.12 * 8e-24 18.0 %
:HMM:SCOP  9->266 1b0pA2 c.36.1.12 * 9.4e-72 37.4 %
:RPS:PFM   63->139 PF02775 * TPP_enzyme_C 8e-07 32.9 %
:RPS:PFM   197->262 PF12367 * PFO_beta_C 9e-14 47.0 %
:HMM:PFM   197->263 PF12367 * PFO_beta_C 1.3e-30 60.6 66/67  
:HMM:PFM   49->193 PF02775 * TPP_enzyme_C 7.2e-30 32.6 135/150  
:BLT:SWISS 13->264 KORB_ARCFU 2e-35 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36241.1 GT:GENE AAD36241.1 GT:PRODUCT 2-oxoacid ferredoxin oxidoreductase, beta subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1179919..1180767 GB:FROM 1179919 GB:TO 1180767 GB:DIRECTION + GB:PRODUCT 2-oxoacid ferredoxin oxidoreductase, beta subunit GB:NOTE similar to GB:AE000666 percent identity: 77.82; identified by sequence similarity; putative GB:PROTEIN_ID AAD36241.1 GB:DB_XREF GI:4981714 LENGTH 282 SQ:AASEQ MRLDEYISRDIAWCPGCGNFGIRTALMKALEELNVDPRQVVIVSGIGQAAKMPQYVGVNMFNGLHGRALPVATAIKTTNPNLLVIAESGDGCMYGEGGNHFIHTIRRNPDIVNIVHDNQVYGLTKGQASPTSLKGFKTPVQVDGVILEPFNPLAVAIALDASFVARTFIGDIEFTKDILKEAMKHKGYALVDILQPCVTFNKLNTYEWYRENTYYLKDHDPTDRELAFKRAIETEKLPLGIFYVNKNKETFEELARKGDRTPLYEYEVNFEKLKELIESKKS GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 13->264|KORB_ARCFU|2e-35|33.8|240/267| SEG 271->281|eklkelieskk| BL:PDB:NREP 1 BL:PDB:REP 21->122|2pgnA|4e-05|26.7|101/587| RP:PDB:NREP 1 RP:PDB:REP 13->211|3ea4A|2e-21|13.7|197/581| RP:PFM:NREP 2 RP:PFM:REP 63->139|PF02775|8e-07|32.9|76/139|TPP_enzyme_C| RP:PFM:REP 197->262|PF12367|9e-14|47.0|66/69|PFO_beta_C| HM:PFM:NREP 2 HM:PFM:REP 197->263|PF12367|1.3e-30|60.6|66/67|PFO_beta_C| HM:PFM:REP 49->193|PF02775|7.2e-30|32.6|135/150|TPP_enzyme_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 51->264|1b0pA2|8e-24|18.0|211/447|c.36.1.12| HM:SCP:REP 9->266|1b0pA2|9.4e-72|37.4|254/0|c.36.1.12|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 506 OP:NHOMOORG 322 OP:PATTERN 22111112111111122232211222222223213112333332212212222123223332221-11 133-1---------11111-11--1111111111111-121222----------------11111111211--------111--21-122232222-1-------1--1----------------1112121211222222---1-----------------------------------------11111-1-111111111111111-1----1111111-1-------1111111111111111111111----------------------------------------------------------------------15312-1--111-1-11------1-1--2--31---232244222313--121---1-------111---11212----------------------------------------1-----------------------1-1------------------------------1111-----------------------------------------------11---1----------------3---352333312233312224222223343--241111111111111111111111111------------------------------11----2----------------------------------------------------------------------------------------------------1111----------------------------------------------------------1------------------------------11------------------------------------------3333233233-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 94.7 SQ:SECSTR cTTcEEEccccccTTcccHHHHHHHHHHHHTTccEcccHHHHHHHHHcccccTTcEEcccccccTTcHHHHHHHHHHHcTTccEEEEEEHHHHHHHTTTHHHHHHHTTccEEEEEEEccccHHHHHHHHHHcTTcccccccccGGGTTcccccHHHHHTHHTTccEEEEccGGGHHHHHHHHHHccccEEEEEEccTTccccccTTccGGGcGGGGGcHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHH############### DISOP:02AL 1-2, 279-282| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHccHHHHHHHHHccccEEEEEEEccEEEccccccccccccccEEEEcccccccccccHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHEEccccccHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHccHHHHHccHHHHHHHHHHHcc //