[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36252.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  395/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:225 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->194 3i76C PDBj 6e-28 34.9 %
:RPS:PDB   3->223 3ed5A PDBj 7e-30 29.8 %
:RPS:SCOP  3->198 2gfhA1  c.108.1.6 * 1e-33 21.6 %
:HMM:SCOP  1->225 1qq5A_ c.108.1.1 * 6.1e-51 36.9 %
:RPS:PFM   5->179 PF00702 * Hydrolase 1e-07 27.6 %
:HMM:PFM   3->192 PF00702 * Hydrolase 1.9e-24 25.7 179/192  
:BLT:SWISS 5->194 YFNB_BACSU 2e-27 34.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36252.1 GT:GENE AAD36252.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1191617..1192294) GB:FROM 1191617 GB:TO 1192294 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AL009126 percent identity: 58.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36252.1 GB:DB_XREF GI:4981726 LENGTH 225 SQ:AASEQ MKKGVLFDLDGTILDFEKSEDQALKRTFLKYGIPLTEDQVFLYREINRKWWKLLAEGKVSKDVVVVARFEEFLKTLNIPLDPRKVAKDYLEFLSEEAHFLPGAEEFLERLKKKDLRMAVVTNGVRFVQEKRSRKLKLDRFFEFVLTSEEAGVEKPDPRIFWLALERMKLKKEEVLYVGDDFSSDLEGARNAGIDFVLFSSDGDSSGDFPVARNFKELEKIVEEFL GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 5->194|YFNB_BACSU|2e-27|34.9|189/235| SEG 199->207|ssdgdssgd| BL:PDB:NREP 1 BL:PDB:REP 5->194|3i76C|6e-28|34.9|189/228| RP:PDB:NREP 1 RP:PDB:REP 3->223|3ed5A|7e-30|29.8|218/226| RP:PFM:NREP 1 RP:PFM:REP 5->179|PF00702|1e-07|27.6|170/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 3->192|PF00702|1.9e-24|25.7|179/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 3->198|2gfhA1|1e-33|21.6|194/243|c.108.1.6| HM:SCP:REP 1->225|1qq5A_|6.1e-51|36.9|217/245|c.108.1.1|1/1|HAD-like| OP:NHOMO 723 OP:NHOMOORG 489 OP:PATTERN ----1-2222222231--------111--11-12111211111--211-131113333333-1----- 1----1--111------11-1-----11111-------------11--------------12---111--1-111-------1--1--2322-211---1-111111111------------------------1----12111111-1------------------2-12--------1------22-----13343454425434451111-15441-1213111111116122222222222222322432121111-11144--111111--22211121111222222221212221111211111111332224332--11411112211112311-11231211--1-111-1--1-11222---2--------------112------------------1-----1--1--1----1---1------1---------------------------------------------------------2-------------------------------------1------1---------------1-----------11--1-----1--1------1-----1------11----------11--------------11111------1-1111111211111132111----11-------21--1111111111111-111111111111111111111111---1111111111111111-1111111--111111111111---------------1-1222--11----1--11133222---11------11------------------111211111122313----------------1-11------------1-1--------------------1-----221122222--- ------------------------1------------------------12122------------------------------------1--1---------2------2--21-11-2111-1112-231-11-111-1-12---1-11--2-1--2----121--1-1--1---1-----2-3--3-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 99.6 SQ:SECSTR cccEEEEcccTTTccHHHHHHHHHHHHHHHTTccccHHHHHTcHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHTTcccccTTHHHHHHHHHTTccEEEEEEcccHHHHHHHHHHTTcGGGccEEEEGGGTTccTTHHHHHHHHHTcTTccGGGEEEEEccTTTTHHHHHHTTcEEEEcTTcccTTccccEEccGGGHHHHHTcH# PSIPRED cccEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccHHHccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHc //