[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36281.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->79 PF04066 * MrpF_PhaF 1e-05 50.0 %
:HMM:PFM   27->80 PF04066 * MrpF_PhaF 2.1e-24 53.7 54/55  
:BLT:SWISS 18->79 MRPF_BACPF 5e-10 38.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36281.1 GT:GENE AAD36281.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1231086..1231334 GB:FROM 1231086 GB:TO 1231334 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AL009126 percent identity: 63.89; identified by sequence similarity; putative GB:PROTEIN_ID AAD36281.1 GB:DB_XREF GI:4981759 LENGTH 82 SQ:AASEQ MSLLFFVLVGAGVLLSFIRVIIGPTSSDRVAALDTMNVMLTGLIVFLAYVFDRAIYLDIALVYALLSFLETIIVSRYLEGRK GT:EXON 1|1-82:0| BL:SWS:NREP 1 BL:SWS:REP 18->79|MRPF_BACPF|5e-10|38.7|62/91| TM:NTM 3 TM:REGION 3->25| TM:REGION 31->53| TM:REGION 57->79| SEG 2->17|sllffvlvgagvllsf| RP:PFM:NREP 1 RP:PFM:REP 28->79|PF04066|1e-05|50.0|52/55|MrpF_PhaF| HM:PFM:NREP 1 HM:PFM:REP 27->80|PF04066|2.1e-24|53.7|54/55|MrpF_PhaF| GO:PFM:NREP 3 GO:PFM GO:0006811|"GO:ion transport"|PF04066|IPR007208| GO:PFM GO:0015075|"GO:ion transmembrane transporter activity"|PF04066|IPR007208| GO:PFM GO:0016021|"GO:integral to membrane"|PF04066|IPR007208| OP:NHOMO 28 OP:NHOMOORG 21 OP:PATTERN ---------------------------------------------1-1-1----22-2222------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------121111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 81-82| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //