[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36283.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->62 PF06123 * CreD 0.00032 19.0 58/430  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36283.1 GT:GENE AAD36283.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1231681..1231893 GB:FROM 1231681 GB:TO 1231893 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:L77117 SP:Q57879 PID:1591141 percent identity: 55.70; identified by sequence similarity; putative GB:PROTEIN_ID AAD36283.1 GB:DB_XREF GI:4981761 LENGTH 70 SQ:AASEQ MMLIAAFFAVEARKILDSVIAFSSLSLLSVFLFIIMKAPDVAITEASVGAGLTTAVLLITLFKMGKDDER GT:EXON 1|1-70:0| TM:NTM 2 TM:REGION 15->37| TM:REGION 42->63| SEG 18->35|sviafsslsllsvflfii| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF06123|0.00032|19.0|58/430|CreD| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 66-70| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccc //