[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36307.1
DDBJ      :             sugar ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
b.40.6c.37.1
:355 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->354 1v43A PDBj e-103 56.6 %
:RPS:PDB   2->354 2d62A PDBj 5e-56 40.4 %
:RPS:SCOP  4->236 1b0uA  c.37.1.12 * 1e-54 32.8 %
:RPS:SCOP  238->346 1oxsC1  b.40.6.3 * 4e-16 23.3 %
:HMM:SCOP  1->234 1g2912 c.37.1.12 * 3e-76 38.9 %
:HMM:SCOP  236->354 1q12A1 b.40.6.3 * 1.2e-26 38.1 %
:RPS:PFM   43->162 PF00005 * ABC_tran 8e-25 47.9 %
:RPS:PFM   275->346 PF08402 * TOBE_2 4e-05 33.8 %
:HMM:PFM   43->161 PF00005 * ABC_tran 3e-25 35.4 113/118  
:HMM:PFM   275->346 PF08402 * TOBE_2 4.2e-06 25.4 71/75  
:HMM:PFM   20->57 PF03193 * DUF258 1.8e-05 21.6 37/161  
:BLT:SWISS 1->349 MALK_VIBCH 3e-94 49.1 %
:PROS 134->148|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36307.1 GT:GENE AAD36307.1 GT:PRODUCT sugar ABC transporter, ATP-binding protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1259522..1260589) GB:FROM 1259522 GB:TO 1260589 GB:DIRECTION - GB:PRODUCT sugar ABC transporter, ATP-binding protein GB:NOTE similar to GB:Pyro_h percent identity: 78.03; identified by sequence similarity; putative GB:PROTEIN_ID AAD36307.1 GB:DB_XREF GI:4981786 LENGTH 355 SQ:AASEQ MAQVKIDGVKKYFGNVRALDGIDLVVNEGEFLVLLGPSGCGKTTLLRCIAGLEQVTGGKIFFNDRDVTNLPPKDRNISMVFQSYAVWPHMKVYDNIAYPLKLKKVPKEEIEKRVKWAADLLHISELLDRYPAQLSGGQRQRVAVARAIVHEPEVLLMDEPLSNLDALLRVKMRSELKKLQERIGVTTIYVTHDQTEAMTMGDRIAVMNQGKLQQVGTPSEIYHHPVNIFVAGFVGSPQMNFLEMEVRSEGNSVVLQNGEIKIPAKTDPGAKKVILGIRPENVYLEEKPNTLKLEGEVYFAEKLMSDTILHLNVGSEKIVAKIPGDVDFRSGEKITFFLDVEKIHLFHPETGERIS GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 1->349|MALK_VIBCH|3e-94|49.1|348/373| PROS 134->148|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->354|1v43A|e-103|56.6|343/353| RP:PDB:NREP 1 RP:PDB:REP 2->354|2d62A|5e-56|40.4|344/361| RP:PFM:NREP 2 RP:PFM:REP 43->162|PF00005|8e-25|47.9|119/123|ABC_tran| RP:PFM:REP 275->346|PF08402|4e-05|33.8|71/72|TOBE_2| HM:PFM:NREP 3 HM:PFM:REP 43->161|PF00005|3e-25|35.4|113/118|ABC_tran| HM:PFM:REP 275->346|PF08402|4.2e-06|25.4|71/75|TOBE_2| HM:PFM:REP 20->57|PF03193|1.8e-05|21.6|37/161|DUF258| GO:PFM:NREP 7 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005215|"GO:transporter activity"|PF08402|IPR013611| GO:PFM GO:0005524|"GO:ATP binding"|PF08402|IPR013611| GO:PFM GO:0006810|"GO:transport"|PF08402|IPR013611| GO:PFM GO:0016820|"GO:hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances"|PF08402|IPR013611| GO:PFM GO:0043190|"GO:ATP-binding cassette (ABC) transporter complex"|PF08402|IPR013611| RP:SCP:NREP 2 RP:SCP:REP 4->236|1b0uA|1e-54|32.8|232/258|c.37.1.12| RP:SCP:REP 238->346|1oxsC1|4e-16|23.3|103/110|b.40.6.3| HM:SCP:REP 1->234|1g2912|3e-76|38.9|234/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 236->354|1q12A1|1.2e-26|38.1|118/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 55732 OP:NHOMOORG 1176 OP:PATTERN ZZODWRMOdbbXbXeUrLWVTYRb*QTmscjYLDFEGFIHIGFVcVbsOT**pAWkVXbQXNNIc19B ZgxQ*jkiqqubgUbXZRQ-QoDDb*RRRRRR*stt****X*e****j*vlS***QYnEF***m*z****ecbbb*dbgP*nsCCEACVUUO6QGKK1-HGUMONjQZTU9B9999BBCCCCCCLXTOWdRPYXcYu****POO*f*tx*mluhqYbQMQNQMnpfr***fNWKQONMVNRKMnejZU*qBZi*************************lr***kv********dpqrprnmoppppoodjeei*mej**iQlcr**TU**hbWcppkmovuz*vs****vyuxuryzsvxghfefhhhjihfg*uqjijsqtnv***********k*px***eppl*yl*z*muXP***ncgkrUcphxsRhecPiaXXNLNMKQfY***hYw****************-wz*po*w***XC**************MNO**********ZYZZZZZZ*glOXnb*778877776689A9CD9BCBAAAAA97B7MEFLFH************************q********BP****x*t*******ftpQaMYphKLLKMKKTTTctog**Tkb*qcszjhuMhedYZenYeggei**b*ROPTHNNNONHDDEEEDEDDIVIJOUTxs*WzWkNXP*TWabXUYjWTUVWZgcXge5-GNbTP321544****d************-************************rqouupsrutuuurtutss**xz****Y7************44LIEGDEFPPQQSM*v*dedadcKTVRPYRWlQSUUSHVJRVyk*************p***HGFEEGFEGNmst*uuvvu*****VVWTSUTPSRGFEF88RXXXOPRRBA8AA9AA*CfFDFDI-DGIENJFRRNDJSFJHBBCft*caz*zzyFlS 4443lpL1jM9DTeSLFKIHLQMWIVMLLGIFHQNQEMHJIJJGFEJILQOPVUJJLFHHGIB9C7872B96DAA7B2879ECDCF46-JSFFEFHA9BHB6ITRQ7QvvodgasjlMJGFNWPwqD*I**t4yVyOOLEnFOudGQIKFiGF*JhTU*Lj*LvSYF*ek*mjkOKPKH*NOILV*ry*H**MP*jyya ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 354-355| PSIPRED ccEEEEEEEEEEcccEEEEccccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEEEcccccccccHHHHHcccHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEccHHHccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHccccccEEEEEEEEEcccEEEEcccEEEEcccccccccEEEEEEEccEEEEEccccccEEEEEEEEEEEEccEEEEEEEEccEEEEEEEccccccccccEEEEEEcHHHEEEEccccccccc //