[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36327.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   84->165 PF00001 * 7tm_1 0.00041 22.0 82/255  
:BLT:SWISS 81->168 Y1592_GEOSW 2e-04 36.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36327.1 GT:GENE AAD36327.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1277659..1278234 GB:FROM 1277659 GB:TO 1278234 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36327.1 GB:DB_XREF GI:4981807 LENGTH 191 SQ:AASEQ MIESFVKGFREIVQNTKLAVISVMALVLGFVTEVLYIFAGKYDFLSFDFFVIKLFEEVLLALLMGLLLVPRRRENLLSLLVFSAFYGLTVSAGFSLFVLPGFVAFMFLFFVPLLSAKDESPSSVLEKNYRMVFKGEKTVDVFLAAAVVFIVWFIPYLGSIISNLLRVVLVYSMYRIMEGSYEKTESDTGSA GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 81->168|Y1592_GEOSW|2e-04|36.0|86/100| TM:NTM 4 TM:REGION 10->32| TM:REGION 48->69| TM:REGION 85->107| TM:REGION 146->168| SEG 59->68|llallmglll| HM:PFM:NREP 1 HM:PFM:REP 84->165|PF00001|0.00041|22.0|82/255|7tm_1| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 120-123, 182-191| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccccc //