[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36341.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:82 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->82 2nzcB PDBj 3e-40 100.0 %
:RPS:PDB   3->74 3bkuC PDBj 3e-11 16.9 %
:RPS:SCOP  2->81 2nzcA1  d.58.18.14 * 4e-26 98.8 %
:HMM:SCOP  1->82 2bj7A2 d.58.18.4 * 1e-05 21.0 %
:HMM:PFM   17->76 PF08753 * NikR_C 0.00018 23.7 59/79  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36341.1 GT:GENE AAD36341.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1292451..1292699 GB:FROM 1292451 GB:TO 1292699 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36341.1 GB:DB_XREF GI:4981823 LENGTH 82 SQ:AASEQ MEKRFYILTIVVEDREKAYRQVNELLHNFSEDILLRVGYPVREENMAIIFLVLKTDNDTIGALSGKLGQISGVRVKTVPLKR GT:EXON 1|1-82:0| BL:PDB:NREP 1 BL:PDB:REP 2->82|2nzcB|3e-40|100.0|80/80| RP:PDB:NREP 1 RP:PDB:REP 3->74|3bkuC|3e-11|16.9|71/83| HM:PFM:NREP 1 HM:PFM:REP 17->76|PF08753|0.00018|23.7|59/79|NikR_C| RP:SCP:NREP 1 RP:SCP:REP 2->81|2nzcA1|4e-26|98.8|80/80|d.58.18.14| HM:SCP:REP 1->82|2bj7A2|1e-05|21.0|81/0|d.58.18.4|1/1|ACT-like| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-------1-11-11----1-1----1-1---1111--111111---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEEEccHHHHHHHHHHHGGGGGGEEEEEEEEccccEEEEEEEEEEEcHHHHHHHHHHHHTccccEEEEEEccc DISOP:02AL 1-2, 81-82| PSIPRED cccEEEEEEEEEEccHHHHHHHHHHHHHHccEEEEEcccccccccEEEEEEEEEccccHHHHHHHHHcccccEEEEEEEccc //