[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36343.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->22 PF04468 * PSP1 0.00075 25.0 20/88  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36343.1 GT:GENE AAD36343.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1294107..1294352 GB:FROM 1294107 GB:TO 1294352 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36343.1 GB:DB_XREF GI:4981825 LENGTH 81 SQ:AASEQ MSDFKRILEEIAEKYNCKIWISEKIGKRWSFYRDLKAGREKFLPAELLVENERFGVFAEDFPEDKRDEVIPLLQKILDELE GT:EXON 1|1-81:0| HM:PFM:NREP 1 HM:PFM:REP 3->22|PF04468|0.00075|25.0|20/88|PSP1| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 80-81| PSIPRED ccHHHHHHHHHHHHHccEEEEHHHHccHHHHHHHHHccHHHcccHHHEEEcccEEEEccccccHHHHHHHHHHHHHHHHcc //