[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36364.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.5
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->116 1rduA PDBj 4e-62 100.0 %
:RPS:SCOP  3->109 1eo1A  c.55.5.1 * 7e-24 43.0 %
:HMM:SCOP  1->116 1rduA_ c.55.5.1 * 9.3e-34 44.8 %
:RPS:PFM   17->102 PF02579 * Nitro_FeMo-Co 2e-09 37.2 %
:HMM:PFM   14->102 PF02579 * Nitro_FeMo-Co 8e-28 41.6 89/94  
:BLT:SWISS 48->108 Y580_METJA 2e-07 32.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36364.1 GT:GENE AAD36364.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1316979..1317329) GB:FROM 1316979 GB:TO 1317329 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000666 percent identity: 63.96; identified by sequence similarity; putative GB:PROTEIN_ID AAD36364.1 GB:DB_XREF GI:4981848 LENGTH 116 SQ:AASEQ MARVAIPSVGKDLSSMVSDRFARAEYFIIYDTESGNVEVVENTIADAHGTGPKVVQSLVSKGVEYLIASNVGRNAFETLKAAGVKVYRFEGGTVQEAIDAFSEGRLEELTTFTREG GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 48->108|Y580_METJA|2e-07|32.8|61/118| BL:PDB:NREP 1 BL:PDB:REP 1->116|1rduA|4e-62|100.0|116/116| RP:PFM:NREP 1 RP:PFM:REP 17->102|PF02579|2e-09|37.2|86/94|Nitro_FeMo-Co| HM:PFM:NREP 1 HM:PFM:REP 14->102|PF02579|8e-28|41.6|89/94|Nitro_FeMo-Co| RP:SCP:NREP 1 RP:SCP:REP 3->109|1eo1A|7e-24|43.0|107/124|c.55.5.1| HM:SCP:REP 1->116|1rduA_|9.3e-34|44.8|116/0|c.55.5.1|1/1|Nitrogenase accessory factor-like| OP:NHOMO 94 OP:NHOMOORG 76 OP:PATTERN --1-1----------------113-----1----1---11111-111123111-111-2-2---2--- --------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111-1---111-----------1-11221111--111-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------13211111-1-------1---21------21----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1221211--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEccccTTccccccGGGccEEEEEETTTTEEEEEEccccccccccccHHHHHHTTTccEEEccccccccHHHHHTTTcEEEccccccHHHHHHHHHTTcccccccccccc DISOP:02AL 46-49, 109-116| PSIPRED cEEEEEEEcccccccccccccccccEEEEEEEcccEEEEEEccccccccccccHHHHHHHccccEEEEccccHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccccccccc //