[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36366.1
DDBJ      :             iron-sulfur cluster-binding protein, putative
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.116.1c.37.1d.58.1
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->113 1fcaA PDBj 4e-07 42.9 %
:BLT:PDB   156->279 1g3qA PDBj 1e-07 32.3 %
:RPS:PDB   62->125 1bqxA PDBj 6e-11 21.9 %
:RPS:PDB   100->278 3ea0B PDBj 8e-17 16.2 %
:RPS:SCOP  56->118 1hfeL2  d.58.1.5 * 1e-10 31.7 %
:RPS:SCOP  151->278 3bbdA1  c.116.1.6 * 3e-12 7.9 %
:HMM:SCOP  1->264 1f48A2 c.37.1.10 * 5.8e-41 29.0 %
:RPS:PFM   150->225 PF01656 * CbiA 1e-07 34.2 %
:RPS:PFM   201->256 PF06574 * FAD_syn 5e-04 37.5 %
:HMM:PFM   4->249 PF01656 * CbiA 6.5e-38 33.8 157/194  
:BLT:SWISS 21->282 Y578_METJA 2e-31 32.5 %
:PROS 99->110|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36366.1 GT:GENE AAD36366.1 GT:PRODUCT iron-sulfur cluster-binding protein, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1318205..1319056) GB:FROM 1318205 GB:TO 1319056 GB:DIRECTION - GB:PRODUCT iron-sulfur cluster-binding protein, putative GB:NOTE similar to GB:AE000782 percent identity: 63.06; identified by sequence similarity; putative GB:PROTEIN_ID AAD36366.1 GB:DB_XREF GI:4981850 LENGTH 283 SQ:AASEQ MTKITVLSGKGGTGKTTVSVNMAKALSESYRVQLLDADVEEPNDHIFFNVDVSFEEPVHLMIPVVDNSVCIRCGECASTCQFGAISVFPSGTFVFESLCHGCGACSIMCPVNAISERPKEIGKIRFGTADGNISFGMGILNIGERTGVPVIRKLKKHIDEKADVVIVDAPPGTSCPVVESLRNTDFALLVTEPTAFGLHDLKLAVELTKEMGIPSGIVVNRYIPGNTIIEEFADEEGIPVLLKIPFKREIASLCAEGKLIVEAFQDMKKDFLELFEKIEVMVR GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 21->282|Y578_METJA|2e-31|32.5|246/276| PROS 99->110|PS00198|4FE4S_FER_1|PDOC00176| SEG 5->20|tvlsgkggtgkttvsv| BL:PDB:NREP 2 BL:PDB:REP 65->113|1fcaA|4e-07|42.9|49/55| BL:PDB:REP 156->279|1g3qA|1e-07|32.3|124/237| RP:PDB:NREP 2 RP:PDB:REP 62->125|1bqxA|6e-11|21.9|64/77| RP:PDB:REP 100->278|3ea0B|8e-17|16.2|179/239| RP:PFM:NREP 2 RP:PFM:REP 150->225|PF01656|1e-07|34.2|76/178|CbiA| RP:PFM:REP 201->256|PF06574|5e-04|37.5|56/157|FAD_syn| HM:PFM:NREP 1 HM:PFM:REP 4->249|PF01656|6.5e-38|33.8|157/194|CbiA| GO:PFM:NREP 2 GO:PFM GO:0003919|"GO:FMN adenylyltransferase activity"|PF06574|IPR015864| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF06574|IPR015864| RP:SCP:NREP 2 RP:SCP:REP 56->118|1hfeL2|1e-10|31.7|63/85|d.58.1.5| RP:SCP:REP 151->278|3bbdA1|3e-12|7.9|126/204|c.116.1.6| HM:SCP:REP 1->264|1f48A2|5.8e-41|29.0|217/278|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 154 OP:NHOMOORG 74 OP:PATTERN ----1-----------2------2----------222-2222---2222322222322222------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---2222222-2---442-----------2122242221-2222-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222222222222-----2---42------22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--22-2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 80.6 SQ:SECSTR #######################################################HHHHHTEEcccTTcccccccccTTcTTccEEEccccEEEcTcccccccccccHHHHHHGGGGccHHHHHHcEEEETTEEEEcccccHHHTccHHHHHHHHHHHHTTccEEEEEccccccTTHHHHGGGccEEEEEEcccHHHHHHHHHHHHHHTTcccccEEEETTTTcccccHHHHHHHHTccccEEccccHHHHHHHHHTccHHHHTcHHHHHHHHHHTccHHccc DISOP:02AL 283-284| PSIPRED ccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHcccccccHHccccccccHHHccccccHHHHcccccEEEccccEEEcHHHHccccccccccccccEEEEEEcEEEEEEcccccccccccHHccccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHcccEEEEccccHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHc //