[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36385.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1311_THEMA  RecName: Full=UPF0150 protein TM_1311;

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.304.1
:70 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->52 2dsyA PDBj 4e-06 13.5 %
:HMM:SCOP  4->51 1wv8A1 d.304.1.1 * 0.00098 35.4 %
:RPS:PFM   13->51 PF03681 * UPF0150 2e-04 46.2 %
:HMM:PFM   13->51 PF03681 * UPF0150 3e-12 41.0 39/48  
:BLT:SWISS 1->70 Y1311_THEMA 1e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36385.1 GT:GENE AAD36385.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1332530..1332742) GB:FROM 1332530 GB:TO 1332742 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36385.1 GB:DB_XREF GI:4981870 LENGTH 70 SQ:AASEQ METQKEIVFIAVESEDGGYIEKTERYSIFTQGDTWEELLEMIKDAVKCHFDEGAPKYVHARFVKDVTIAV GT:EXON 1|1-70:0| SW:ID Y1311_THEMA SW:DE RecName: Full=UPF0150 protein TM_1311; SW:GN OrderedLocusNames=TM_1311; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->70|Y1311_THEMA|1e-37|100.0|70/70| RP:PDB:NREP 1 RP:PDB:REP 1->52|2dsyA|4e-06|13.5|52/78| RP:PFM:NREP 1 RP:PFM:REP 13->51|PF03681|2e-04|46.2|39/48|UPF0150| HM:PFM:NREP 1 HM:PFM:REP 13->51|PF03681|3e-12|41.0|39/48|UPF0150| HM:SCP:REP 4->51|1wv8A1|0.00098|35.4|48/0|d.304.1.1|1/1|TTHA1013-like| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---2--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 74.3 SQ:SECSTR HHHHHTcEEEEccccccEEEEcTTcTTcEEEEccHHHHHHHHHHHHHHHHHH################## DISOP:02AL 1-3| PSIPRED cccccEEEEEEEEcccccEEEEEEEHHEEcccccHHHHHHHHHHHHEEEcccccccEEEEEEEEEEEEcc //