[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36386.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.50.3
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->70 1whzA PDBj 3e-09 40.0 %
:RPS:SCOP  7->70 1whzA  d.50.3.2 * 2e-18 36.5 %
:HMM:SCOP  3->73 1whzA_ d.50.3.2 * 1.7e-17 35.7 %
:RPS:PFM   14->65 PF07927 * YcfA 1e-05 47.1 %
:HMM:PFM   10->65 PF07927 * YcfA 2.5e-18 37.5 56/58  
:HMM:PFM   55->76 PF02861 * Clp_N 0.00064 22.7 22/53  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36386.1 GT:GENE AAD36386.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1332765..1332998) GB:FROM 1332765 GB:TO 1332998 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to PID:1652005 percent identity: 53.95; identified by sequence similarity; putative GB:PROTEIN_ID AAD36386.1 GB:DB_XREF GI:4981871 LENGTH 77 SQ:AASEQ MSYLPIVDPKTMEKVLLKLGFQRVRQKGSHVFYRHSNGKYTTIPFHAKETCPSHLIRKIIREAGISVEEFKKVLENL GT:EXON 1|1-77:0| BL:PDB:NREP 1 BL:PDB:REP 9->70|1whzA|3e-09|40.0|60/67| RP:PFM:NREP 1 RP:PFM:REP 14->65|PF07927|1e-05|47.1|51/57|YcfA| HM:PFM:NREP 2 HM:PFM:REP 10->65|PF07927|2.5e-18|37.5|56/58|YcfA| HM:PFM:REP 55->76|PF02861|0.00064|22.7|22/53|Clp_N| RP:SCP:NREP 1 RP:SCP:REP 7->70|1whzA|2e-18|36.5|63/70|d.50.3.2| HM:SCP:REP 3->73|1whzA_|1.7e-17|35.7|70/0|d.50.3.2|1/1|YcfA/nrd intein domain| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -----------------------------------------------1--2-1--------------- --1------------------------------------------------------------------------------------------------------------------------------------------------11---1---------1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 77.9 SQ:SECSTR ########HHHHHHHHHHTTcEE#EEETTEEEEEcTTccEEEEEccccc#ccHHHHHHHHHHTTccHHHH####### DISOP:02AL 1-2, 4-5| PSIPRED ccccccccHHHHHHHHHHcccEEEEEEccEEEEEEccccEEEEEcccccccccHHHHHHHHHccccHHHHHHHHHcc //